Quick Search

Enter gene name or accession number


Search term: Rv1032c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nametrcS
Rv numberRv1032c
TypeCDS
FunctionSensor part of the two component regulatory system TRCS/TRCR.
ProductTwo component sensor histidine kinase TrcS
CommentsRv1032c, (MTCY10G2.17), len: 509 aa. TrcS, two component sensor histidine kinase protein (see citations below), similar to YV16_MYCLE|P54883 probable sensor-like histidine kinase from Mycobacterium leprae (443 aa), FASTA scores: opt: 392, E(): 3.8e-18, (31.7% identity in 334 aa overlap). Note that in vitro autophosphorylation of TrcS requires the presence of Mn2+ or Ca2+ as a divalent cation cofactor and subsequent transphosphorylation of TrcR is evident in the presence of TrcS-phosphate and Ca2+.
Molecular mass (Da)54590.9
Isoelectric point5.5571
Gene length (bp)1530
Protein length509
Location (kb)1156.43


Functional categoryregulatory proteins


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Growth of M. tuberculosis Mt103 transposon mutant in BALB/c mice and in mouse bone marrow-derived macrophages is unaffected (See Ewann et al., 2002). M. tuberculosis H37Rv mutant shows increased virulence in SCID mice (See Parish et al., 2004).
see TB knockouts/mutants availability


Coordinates
TypeStartEndOrientation
CDS11564261157955-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1032c|trcS
MIPDRNTRSRKAPCWRPRSLRQQLLLGVLAVVTVVLVAVGVVSVLSLSGYVTAMNDAELV
ESLHALNHSYTRYRDSAQTSTPTGNLPMSQAVLEFTGQTPGNLIAVLHDGVVIGSAVFSE
DGARPAPPDVIRAIEAQVWDGGPPRVESLGSLGAYQVDSSAAGADRLFVGVSLSLANQII
ARKKVTTVALVGAALVVTAALTVWVVGYALRPLRRVAATAAEVATMPLTDDDHQISVRVR
PGDTDPDNEVGIVGHTLNRLLDNVDGALAHRVDSDLRMRQFITDASHELRTPLAAIQGYA
ELTRQDSSDLPPTTEYALARIESEARRMTLLVDELLLLSRLSEGEDLETEDLDLTDLVIN
AVNDAAVAAPTHRWVKNLPDEPVWVNGDHARLHQLVSNLLTNAWVHTQPGVTVTIGITCH
RTGPNAPCVELSVTDDGPDIDPEILPHLFDRFVRASKSRSNGSGHGLGLAIVSSIVKAHR
GSVTAESGNGQTVFRVRLPMIEQQIATTA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP96368


Orthologs/Cross-references
CDC1551MT1061
Enzyme Classification2.7.13.3
Gene Ontologytwo-component sensor activity
two-component signal transduction system (phosphorelay)
ATP binding
signal transduction
integral to membrane
peptidyl-histidine phosphorylation
M. bovisMb1061c
M. lepraeML0260
M. marinumMMAR_4456
M. smegmatisMSMEG_2915
UniProtP96368
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1032c


Expression Data
TBDBRv1032c


Bibliography
Benjamin Jr WH, Haydel SE, Dunlap NE, Benjamin WH,
In vitro evidence of two-component system phosphorylation between the Mycobacterium tuberculosis TrcR/TrcS proteins
Microb Pathog (1999) 26(4):195-206
Cited for: Product/Regulation/Biochemistry
Ewann F, Jackson M, Pethe K, Cooper A, Mielcarek N, Ensergueix D, Gicquel B, Locht C, Supply P,
Transient requirement of the PrrA-PrrB two-component system for early intracellular multiplication of Mycobacterium tuberculosis
Infect Immun (2002) 70(5):2256-63
Cited for: Mutant
Parish T, Smith DA, Kendall S, Casali N, Bancroft GJ, Stoker NG,
Deletion of two-component regulatory systems increases the virulence of Mycobacterium tuberculosis.
Infect Immun (2003) 71(3):1134-40
Cited for: Mutant/Secondary/Function
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant