Quick Search

Enter gene name or accession number


Search term: Rv1031

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namekdpC
Rv numberRv1031
TypeCDS
FunctionOne of the components of the high-affinity ATP-driven potassium transport (or KDP) system, which catalyzes the hydrolysis of ATP coupled with the exchange of hydrogen and potassium ions. The C subunit may be involved in assembly of the KDP complex. [catalytic activity: ATP + H(2)O + K(+)(out) = ADP + phosphate + K(+)(in)].
ProductProbable potassium-transporting ATPase C chain KdpC (potassium-translocating ATPase C chain) (ATP phosphohydrolase [potassium-transporting] C chain) (potassium binding and translocating subunit C)
CommentsRv1031, (MTCY10G2.18c), len: 189 aa. Probable kdpC, potassium-transporting ATPase C chain (membrane protein) , similar to others e.g. ATKC_ECOLI|P03961 potassium-transporting ATPase C chain from Escherichia coli strain K12 (190 aa), FASTA scores: opt: 475, E(): 3.1e-24, (45.7% identity in 186 aa overlap); etc. Belongs to the KdpC family.
Molecular mass (Da)20027.9
Isoelectric point8.9462
Gene length (bp)570
Protein length189
Location (kb)1155.85


Functional categorycell wall and cell processes


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11558531156422+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1031|kdpC
MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQF
TAAKYFHPRPSSAGDGYDAAASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVD
AVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLIEDHTDARGLGFLGERAVNVL
RLNLALDRL
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP65211


Orthologs/Cross-references
CDC1551MT1060
Enzyme Classification3.6.3.12
Gene OntologyATP binding
plasma membrane
potassium ion transport
potassium-transporting ATPase activity
integral to membrane
M. bovisMb1060
M. smegmatisMSMEG_5394
UniProtP65211
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1031


Expression Data
TBDBRv1031


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics