Quick Search

Enter gene name or accession number


Search term: Rv1030

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namekdpB
Rv numberRv1030
TypeCDS
FunctionOne of the components of the high-affinity ATP-driven potassium transport (or KDP) system, which catalyzes the hydrolysis of ATP coupled with the exchange of hydrogen and potassium ions [catalytic activity:ATP + H(2)O + K(+)(out) = ADP + phosphate + K(+)(in)].
ProductProbable potassium-transporting P-type ATPase B chain KdpB (potassium-translocating ATPase B chain) (ATP phosphohydrolase [potassium-transporting] B chain) (potassium binding and translocating subunit B)
CommentsRv1030, (MTCY10G2.19c), len: 709 aa. Probable kdpB, potassium-transporting P-type ATPase B chain (transmembrane protein), similar to others e.g. ATKB_ECOLI|P03960 potassium-transporting ATPase B chain from Escherichia coli strain K12 (682 aa), FASTA scores: opt: 1481, E(): 0, (63.4% identity in 686 aa overlap); etc. Very similar to AL078610|SCH35.47 H+/K+-exchanging ATPase chain B from Streptomyces coelicolor (707 aa), FASTA scores: opt: 2731, E(): 0, (71.6% identity in 676 aa overlap). Contains PS00154 E1-E2 ATPases phosphorylation site.
Molecular mass (Da)74601.5
Isoelectric point6.3103
Gene length (bp)2130
Protein length709
Location (kb)1153.72


Functional categorycell wall and cell processes


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11537241155853+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1030|kdpB
VMIARMETSATAAAATSAPRLRLAKRSLFDPMIVRSALPQSLRKLAPRVQARNPVMLVVL
VGAVITTLAFLRDLASSTAQENVFNGLVAAFLWFTVLFANFAEAMAEGRGKAQAAALRKV
RSETMANRRTAAGNIESVPSSRLDLDDVVEVSAGETIPSDGEIIEGIASVDESAITGESA
PVIRESGGDRSAVTGGTVVLSDRIVVRITAKQGQTFIDRMIALVEGAARQQTPNEIALNI
LLAGLTIIFLLAVVTLQPFAIYSGGGQRVVVLVALLVCLIPTTIGALLSAIGIAGMDRLV
QHNVLATSGRAVEAAGDVNTLLLDKTGTITLGNRQATEFVPINGVSAEAVADAAQLSSLA
DETPEGRSIVVLAKDEFGLRARDEGVMSHARFVPFTAETRMSGVDLAEVSGIRRIRKGAA
AAVMKWVRDHGGHPTEEVGAIVDGISSGGGTPLVVAEWTDNSSARAIGVVHLKDIVKVGI
RERFDEMRRMSIRTVMITGDNPATAKAIAQEAGVDDFLAEATPEDKLALIKREQQGGRLV
AMTGDGTNDAPALAQADVGVAMNTGTQAAREAGNMVDLDSDPTKLIEVVEIGKQLLITRG
ALTTFSIANDVAKYFAIIPAMFVGLYPVLDKLNVMALHSPRSAILSAVIFNALVIVALIP
LALRGVRFRAESASAMLRRNLLIYGLGGLVVPFIGIKLVDLVIVALGVS
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP63681


Orthologs/Cross-references
CDC1551MT1059
Enzyme Classification3.6.3.12
Gene Ontologymagnesium ion binding
ATP binding
plasma membrane
ATP biosynthetic process
potassium ion transport
potassium-transporting ATPase activity
integral to membrane
M. bovisMb1059
M. marinumMMAR_0632
M. smegmatisMSMEG_5393
UniProtP63681
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1030


Expression Data
TBDBRv1030


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant