Quick Search

Enter gene name or accession number


Search term: Rv1029

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namekdpA
Rv numberRv1029
TypeCDS
FunctionOne of the components of the high-affinity ATP-driven potassium transport (or KDP) system, which catalyzes the hydrolysis of ATP coupled with the exchange of hydrogen and potassium ions [catalytic activity: ATP + H(2)O + K(+)(out) = ADP + phosphate + K(+)(in)].
ProductProbable potassium-transporting ATPase a chain KdpA (potassium-translocating ATPase a chain) (ATP phosphohydrolase [potassium-transporting] a chain) (potassium binding and translocating subunit A)
CommentsRv1029, (MTCY10G2.20c), len: 571 aa. Probable kdpA, potassium-transporting ATPase a chain (transmembrane protein), similar to others e.g. ATKA_ECOLI|P03959|KDPA|B0698 potassium-transporting ATPase A chain from Escherichia coli strain K12 (557 aa), FASTA scores: opt: 1763, E(): 0, (50.4% identity in 569 aa overlap); etc. Belongs to the KdpA family.
Molecular mass (Da)60163.2
Isoelectric point9.3631
Gene length (bp)1716
Protein length571
Location (kb)1152.01


Functional categorycell wall and cell processes


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11520121153727+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1029|kdpA
MSGTSWLQFAALIAVLLLTAPALGGYLAKIYGDEAKKPGDRVFGPIERVIYQVCRVDPGS
EQRWSTYALSVLAFSVMSFLLLYGIARFQGVLPFNPTDKPAVTDHVAFNAAVSFMTNTNW
QSYSGEATMSHFTQMTGLAVQNFVSASAGMCVLAALIRGLARKRASTLGNFWVDLARTVL
RIMFPLSFVVAILLVSQGVIQNLHGFIVANTLEGAPQLIPGGPVASQVAIKQLGTNGGGF
FNVNSAHPFENYTPIGNFVENWAILIIPFALCFAFGKMVHDRRQGWAVLAIMGIIWIGMS
VAAMSFEAKGNPRLDALGVTQQTTVDQSGGNLEGKEVRFGVGASGLWAASTTGTSNGSVN
SMHDSYTPLGGMVPLAHMMLGEVSPGGTGVGLNGLLVMAILAVFIAGLMVGRTPEYLGKK
IQATEMKLVTLYILAMPIALLSFAAASVLISSALASRNNPGPHGLSEILYAYTSGANNNG
SAFAGLTASTWSYDTTIGVAMLIGRFFLIIPVLAIAGSLARKGTTPVTAATFPTHKPLFV
GLVIGVVLIVGGLTFFPALALGPIVEQLSTQ
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP65209


Orthologs/Cross-references
CDC1551MT1058
Enzyme Classification3.6.3.12
Gene OntologyATP binding
plasma membrane
potassium ion transport
potassium-transporting ATPase activity
integral to membrane
M. bovisMb1058
M. marinumMMAR_0631
M. smegmatisMSMEG_5392
UniProtP65209
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1029


Expression Data
TBDBRv1029


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant