Quick Search

Enter gene name or accession number


Search term: Rv1028A

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namekdpF
Rv numberRv1028A
TypeCDS
FunctionThought to be involved in stabilization of the KDP complex.
ProductProbable membrane protein KdpF
CommentsRv1028A, len: 30 aa. Probable kdpF, membrane protein, showing similarity with P36937|KDPF_ECOLI|B0698.1 protein KDPF from Escherichia coli strain K12 (see citation below) (27% identity); and KdpF protein from Streptomyces coelicolor (51% identity).
Molecular mass (Da)3256.01
Isoelectric point4.1843
Gene length (bp)93
Protein length30
Location (kb)1151.92


Functional categorycell wall and cell processes


MutationNon-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11519201152012+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1028A|kdpF
MTTVDNIVGLVIAVALMAFLFAALLFPEKF
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ79FT7


Orthologs/Cross-references
M. bovisMb1057
UniProtQ79FT7
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1028A


Expression Data
TBDBRv1028A


Bibliography
Gassel M, Mollenkamp T, Puppe W, Altendorf K,
Analysis of KdpC of the K(+)-transporting KdpFABC complex of Escherichia coli
Eur J Biochem (2001) 268(6):1772-81
Cited for: Homolog/Function
Li C, Gao P, Qin H, Chase R, Gor'kov PL, Brey WW, Cross TA,
Uniformly aligned full-length membrane proteins in liquid crystalline bilayers for structural characterization.
J Am Chem Soc (2007) 129(17):5304-5
Cited for: Structure
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant