Quick Search

Enter gene name or accession number


Search term: Rv1026

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1026
Rv numberRv1026
TypeCDS
FunctionUnknown. Could be involved in an adaptive process that allows bacteria to respond to amino acid starvation.
ProductConserved protein
CommentsRv1026, (MTCY10G2.23c), len: 319 aa. Conserved protein. Similar to GPPA_ECOLI|P25552 guanosine-5'-triphosphate,3'-diphosphate pyrophoshatase from Escherichia coli (494 aa), FASTA scores: opt: 281, E(): 3.2e-11, (30.6% identity in 291 aa overlap). Equivalent to AL023514|MLCB4.02 hypothetical protein from Mycobacterium leprae (317 aa) (77.9% identity in 321 aa overlap).
Molecular mass (Da)33631.4
Isoelectric point5.4031
Gene length (bp)960
Protein length319
Location (kb)1147.02


Functional categoryvirulence, detoxification, adaptation


ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11470191147978+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1026|Rv1026
VALTRVAAIDCGTNSIRLLIADVGAGLARGELHDVHRETRIVRLGQGVDATGRFAPEAIA
RTRTALTDYAELLTFHHAERVRMVATSAARDVVNRDVFFAMTADVLGAALPGSAAEVITG
AEEAELSFRGAVGELGSAGAPFVVVDLGGGSTEIVLGEHEVVASYSADIGCVRLTERCLH
SDPPTLQEVSTARRLVRERLEPALRTVPLELARTWVGLAGTMTTLSALAQSMTAYDAAAI
HLSRVPGADLLEVCQRLIGMTRKQRAALAPMHPGRADVIGGGAIVVEELARELRERAGID
QLTVSEHDILDGIALSLAG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP96374


Orthologs/Cross-references
CDC1551MT1054
Gene Ontologyhydrolase activity
M. bovisMb1054
M. lepraeML0258
M. marinumMMAR_4459
M. smegmatisMSMEG_5413
UniProtP96374
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1026


Expression Data
TBDBRv1026


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence