Quick Search

Enter gene name or accession number


Search term: Rv1025

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1025
Rv numberRv1025
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv1025, (MTCY10G2.24c), len: 155 aa. Conserved protein, similar to hypothetical protein AE001768|AE001768_4 Thermotoga maritima (170 aa) FASTA scores: opt: 254, E(): 9.5e-10, (35.7% identity in 143 aa overlap).
Molecular mass (Da)16593.1
Isoelectric point9.5473
Gene length (bp)468
Protein length155
Location (kb)1146.56


Functional categoryconserved hypotheticals


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11465611147028+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1025|Rv1025
VVTRQLGRAPRGVLAIAYRCPNGEPGVVKTAPRLPDGTPFPTLYYLTHPVLTAAASRLET
TGLMREMNRRLGQDAELAAAYRRAHESYLSERDALEPLGTTVSAGGMPDRVKCLHVLIAH
SLAKGPGLNPFGDEALALLAAEPRTAATLVAGQWR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP96375


Orthologs/Cross-references
CDC1551MT1053
M. bovisMb1053
M. lepraeML0257
M. marinumMMAR_4460
UniProtP96375
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1025


Expression Data
TBDBRv1025


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant