Quick Search

Enter gene name or accession number


Search term: Rv1024

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv1024
Rv numberRv1024
TypeCDS
FunctionUnknown
ProductPossible conserved membrane protein
CommentsRv1024, (MTCY10G2.25c), len: 228 aa. Possible conserved membrane protein, with a hydrophobic region from aa 83-101. Equivalent to ML0256|NP_301311.1|NC_002677 possible conserved membrane protein from Mycobacterium leprae (227 aa), S&W scores: 178, E()= 2e-72, Identities: 145/203 (71%). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Molecular mass (Da)24570
Isoelectric point10.448
Gene length (bp)687
Protein length228
Location (kb)1145.86


Functional categorycell wall and cell processes


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomeDNA microarrays detect expression in M. tuberculosis H37Rv in vivo (in BALB/c and SCID mice) but not in vitro (in 7H9 medium) (See Talaat et al., 2004).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11458581146544+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1024|Rv1024
MPEAKRPESKRRSPASRPGKAGDSVRGGRATKPSAKPSTPAPHASRKTTRTPHEHIVEPI
KRAITESVEKRSEQRLGFTARRAAILAAVVCVLTLTIARPVRTYFAQRAEMEQLAATEAM
LRRQIADLEEQQVKLADPAYIAAQARERLGFVMPGDIPFQVQLPSTPLAPPQPGSDAATA
TNNEPWYTALWHTIADDPHLPPAAPPAPEPGRPGPLPPASPNPEQPGG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP96376


Orthologs/Cross-references
CDC1551MT1052
Gene Ontologyplasma membrane
cell cycle
integral to membrane
cell division
M. bovisMb1052
M. lepraeML0256
M. marinumMMAR_4461
UniProtP96376
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1024


Expression Data
TBDBRv1024


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST, Brosch R,
Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex.
Microbiology (2004) 150(Pt 2):483-96
Cited for: Homology
Talaat AM, Lyons R, Howard ST, Johnston SA,
The temporal expression profile of Mycobacterium tuberculosis infection in mice.
Proc Natl Acad Sci U S A (2004) 101(13):4602-7
Cited for: Transcriptome
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant