Quick Search

Enter gene name or accession number


Search term: Rv1023

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameeno
Rv numberRv1023
TypeCDS
FunctionGlycolysis [catalytic activity:2-phospho-D-glycerate = phosphoenolpyruvate + H(2)O]
ProductProbable enolase Eno
CommentsRv1023, (MTCY10G2.26c), len: 429 aa. Probable eno, enolase, highly similar to others e.g. ENO_ECOLI|P08324 enolase from Escherichia coli (431 aa), FASTA scores: opt: 1487, E(): 0, (55.5% identity in 422 aa overlap); etc. Magnesium is required for catalysis and for stabilizing the dimer. Belongs to the enolase family.
Molecular mass (Da)44929.5
Isoelectric point4.2554
Gene length (bp)1290
Protein length429
Location (kb)1144.56


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in Triton X-114 extracts of M. tuberculosis H37Rv membranes using 2DGE and MALDI-MS (See Sinha et al., 2002). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the aqueous phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE, 2-DGE, and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS11445641145853+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1023|eno
VPIIEQVRAREILDSRGNPTVEVEVALIDGTFARAAVPSGASTGEHEAVELRDGGDRYGG
KGVQKAVQAVLDEIGPAVIGLNADDQRLVDQALVDLDGTPDKSRLGGNAILGVSLAVAKA
AADSAELPLFRYVGGPNAHILPVPMMNILNGGAHADTAVDIQEFMVAPIGAPSFVEALRW
GAEVYHALKSVLKKEGLSTGLGDEGGFAPDVAGTTAALDLISRAIESAGLRPGADVALAL
DAAATEFFTDGTGYVFEGTTRTADQMTEFYAGLLGAYPLVSIEDPLSEDDWDGWAALTAS
IGDRVQIVGDDIFVTNPERLEEGIERGVANALLVKVNQIGTLTETLDAVTLAHHGGYRTM
ISHRSGETEDTMIADLAVAIGSGQIKTGAPARSERVAKYNQLLRIEEALGDAARYAGDLA
FPRFACETK
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP96377


Orthologs/Cross-references
CDC1551MT1051
Enzyme Classification4.2.1.11
Gene Ontologyphosphopyruvate hydratase complex
magnesium ion binding
phosphopyruvate hydratase activity
extracellular region
glycolysis
cell surface
M. bovisMb1051
M. lepraeML0255
M. marinumMMAR_4462
M. smegmatisMSMEG_5415
UniProtP96377
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1023


Expression Data
TBDBRv1023


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P, Cole ST,
Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics.
Microbiology (2005) 151(Pt 7):2411-9
Cited for: Proteomics
Sinha S, Arora S, Kosalai K, Namane A, Pym AS, Cole ST,
Proteome analysis of the plasma membrane of Mycobacterium tuberculosis.
Comp Funct Genomics (2002) 3(6):470-83
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant