Quick Search

Enter gene name or accession number


Search term: Rv0904c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameaccD3
Rv numberRv0904c
TypeCDS
FunctionThis protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA [catalytic activity ATP + acetyl-CoA + HCO(3)(-) = ADP + phosphate + malonyl-CoA].
ProductPutative acetyl-coenzyme A carboxylase carboxyl transferase (subunit beta) AccD3 (accase beta chain)
CommentsRv0904c, (MTCY31.32c, MT0927), len: 495 aa. Putative accD3, acetyl-CoA carboxylase carboxyl transferase, beta subunit (carboxyltransferase subunit of acetyl-CoA carboxylase), highly similar in part to AAA63045.1|U15184 zinc finger protein from Mycobacterium leprae (201 aa). Also highly similar to others e.g. CAC42827.1|Y17592 putative carboxyltransferase subunit of acetyl-CoA carboxylase from Corynebacterium glutamicum (491 aa); CAB86110.1|AL163003 putative acetyl CoA carboxylase (alpha and beta subunits) from Streptomyces coelicolor (458 aa); Q54776|ACCD_SYNP7 acetyl-coenzyme A carboxylase carboxyl transferase subunit beta from Synechococcus sp. (305 aa); P12217|ACCD_MARPO acetyl-coenzyme A carboxylase carboxyl transferase subunit beta from Marchantia polymorpha (316 aa), FASTA scores: opt: 519, E():1.6e-24, (40.2% identity in 219 aa overlap); etc. Also similar to Rv3280, Rv2502c, etc from Mycobacterium tuberculosis. Belongs to the ACCD/PCCB family.
Molecular mass (Da)51740.3
Isoelectric point6.5198
Gene length (bp)1488
Protein length495
Location (kb)1006.69


Functional categorylipid metabolism


ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS10066931008180-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0904c|accD3
VSRITTDQLRHAVLDRGSFVSWDSEPLAVPVADSYARELAAARAATGADESVQTGEGRVF
GRRVAVVACEFDFLGGSIGVAAAERITAAVERATAERLPLLASPSSGGTRMQEGTVAFLQ
MVKIAAAIQLHNQARLPYLVYLRHPTTGGVFASWGSLGHLTVAEPGALIGFLGPRVYELL
YGDPFPSGVQTAENLRRHGIIDGVVALDRLRPMLDRALTVLIDAPEPLPAPQTPAPVPDV
PTWDSVVASRRPDRPGVRQLLRHGATDRVLLSGTDQGEAATTLLALARFGGQPTVVLGQQ
RAVGGGGSTVGPAALREARRGMALAAELCLPLVLVIDAAGPALSAAAEQGGLAGQIAHCL
AELVTLDTPTVSILLGQGSGGPALAMLPADRVLAALHGWLAPLPPEGASAIVFRDTAHAA
ELAAAQGIRSADLLKSGIVDTIVPEYPDAADEPIEFALRLSNAIAAEVHALRKIPAPERL
ATRLQRYRRIGLPRD
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP63405


Orthologs/Cross-references
CDC1551MT0927
Enzyme Classification6.4.1.2
Gene Ontologyacetyl-CoA carboxylase activity
ATP binding
fatty acid biosynthetic process
acetyl-CoA carboxylase complex
M. bovisMb0928c
M. lepraeML2119
M. marinumMMAR_4626
M. smegmatisMSMEG_5642
UniProtP63405
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0904c


Expression Data
TBDBRv0904c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant