Quick Search

Enter gene name or accession number


Search term: Rv0502

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0502
Rv numberRv0502
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv0502, (MTCY20G9.29), len: 358 aa. Conserved protein, equivalent to P54878|Y502_MYCLE|ML2427 hypothetical 40.5 KDA protein from Mycobacterium leprae (367 aa), FASTA scores: opt: 2042, E(): 0, (84.1% identity in 365 aa overlap). Also similar to T36273|SCE68.23c hypothetical protein from Streptomyces coelicolor (355 aa). C-terminal similar to AL021529|SC10A5_4|T34572 hypothetical protein from Streptomyces coelicolor (295 aa), FASTA score: (57.8% identity in 263 aa overlap); and to hypothetical proteins from Mycobacterium tuberculosis Rv1920|G70808 (287 aa); and Rv1428c|G70914 (275 aa).
Molecular mass (Da)39287.9
Isoelectric point8.1266
Gene length (bp)1077
Protein length358
Location (kb)592.791


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: intermediary metabolism and respiration (See Mazandu and Mulder, 2012)


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS592791593867+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0502|Rv0502
MGNVAGETRANVIPLHTNRSRVAARRRAGQRAESRQHPSLLSDPNDRASAEQIAAVVREI
DEHRRAAGATTSSTEATPNDLAQLVAAVAGFLRQRLTGDYSVDEFGFDPHFNSAIVRPLL
RFFFKSWFRVEVSGVENIPRDGAALVVANHAGVLPFDGLMLSVAVHDEHPAHRDLRLLAA
DMVFDLPVIGEAARKAGHTMACTTDAHRLLASGELTAVFPEGYKGLGKRFEDRYRLQRFG
RGGFVSAALRTKAPIVPCSIIGSEEIYPMLTDVKLLARLFGLPYFPITPLFPLAGPVGLV
PLPSKWRIAFGEPICTADYASTDADDPMVTFELTDQVRETIQQTLYRLLAGRRNIFFG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP64723


Orthologs/Cross-references
CDC1551MT0523
Gene Ontologymetabolic process
acyltransferase activity
M. bovisMb0514
M. lepraeML2427
M. marinumMMAR_0830
M. smegmatisMSMEG_0947
UniProtP64723
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0502


Expression Data
TBDBRv0502


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function