Quick Search

Enter gene name or accession number


Search term: Rv0501

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namegalE2
Rv numberRv0501
Synonym(s)galE1
TypeCDS
FunctionInvolved in galactose metabolism [catalytic activity: UDP-glucose = UDP-galactose].
ProductPossible UDP-glucose 4-epimerase GalE2 (galactowaldenase) (UDP-galactose 4-epimerase) (uridine diphosphate galactose 4-epimerase) (uridine diphospho-galactose 4-epimerase)
CommentsRv0501, (MTCY20G9.28), len: 376 aa. Possible galE2, UDP-glucose 4-epimerase, highly similar (except in N-terminus) to CAC31944.1|AL583925 possible glucose epimerase/dehydratase from Mycobacterium leprae (364 aa). N-terminus highly similar to S72923|B2168_C1_174|467075|AAA17259.1|U00018 hypothetical protein from Mycobacterium leprae (180 aa), FASTA scores: opt: 934, E(): 0, (89.6% identity in 164 aa overlap); and C-terminus highly similar to S72898|467050|AAA17234.1|U00018 hypothetical protein from Mycobacterium leprae (168 aa), FASTA scores: opt: 928, E(): 0, (82.7% identity in 168 aa overlap). Also highly similar to T36274|5123671|CAB45360.1|AL079345 probable epimerase from Streptomyces coelicolor (353 aa); and similar in part to other epimerases e.g. GALE_ECOLI|P09147 UDP-glucose 4-epimerase from Escherichia coli (338 aa), FASTA scores: opt: 241, E(): 6.7e-09, (28.2% identity in 294 aa overlap); etc. Belongs to the sugar epimerase family. Cofactor: NAD. Note that previously known as galE1.
Molecular mass (Da)41032.1
Isoelectric point10.8518
Gene length (bp)1131
Protein length376
Location (kb)591.654


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified in the cytosol and cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS591654592784+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0501|galE2
VSSSNGRGGAGGVGGSSEHPQYPKVVLVTGACRFLGGYLTARLAQNPLINRVIAVDAIAP
SKDMLRRMGRAEFVRADIRNPFIAKVIRNGEVDTVVHAAAASYAPRSGGSAALKELNVMG
AMQLFAACQKAPSVRRVVLKSTSEVYGSSPHDPVMFTEDSSSRRPFSQGFPKDSLDIEGY
VRALGRRRPDIAVTILRLANMIGPAMDTTLSRYLAGPLVPTIFGRDARLQLLHEQDALGA
LERAAMAGKAGTFNIGADGILMLSQAIRRAGRIPVPVPGFGVWALDSLRRANHYTELNRE
QFAYLSYGRVMDTTRMRVELGYQPKWTTVEAFDDYFRGRGLTPIIDPHRVRSWEGRAVGL
AQRWGSRNPIPWSGLR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP0A5D1


Orthologs/Cross-references
CDC1551MT0522
Gene Ontologycatalytic activity
cellular metabolic process
coenzyme binding
M. bovisMb0513
M. lepraeML2428
M. marinumMMAR_0829
M. smegmatisMSMEG_0946
UniProtP0A5D1
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0501


Expression Data
TBDBRv0501


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Malen H, Berven FS, Fladmark KE, Wiker HG,
Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
Proteomics (2007) 7(10):1702-18
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant