Quick Search

Enter gene name or accession number


Search term: Rv0500A

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0500A
Rv numberRv0500A
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv0500A, len: 78 aa. Conserved protein, similar to proteins from Mycobacterium leprae and Streptomyces coelicolor e.g. U00018_25 from Mycobacterium leprae cosmid B2168 (86 aa), FASTA scores: opt: 428, E(): 1.3e-27, (82.6% identity in 86 aa overlap); AL079345|SCE68_26 from Streptomyces coelicolor cosmid E6 (70 aa), FASTA scores: opt: 252, E(): 1.2 e-13, (72.2 identity in 54 aa overlap).
Molecular mass (Da)8507.73
Isoelectric point9.86
Gene length (bp)237
Protein length78
Location (kb)591.111


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: insertion seqs and phages (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutationNon-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS591111591347+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0500A|Rv0500A
MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLVHNGELPAVRVGRSFR
VHAKAVHDMLETSYFDAG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT0521
Gene OntologyDNA binding
M. bovisMb0512
M. lepraeML2429
UniProtQ8VKK5
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0500A


Expression Data
TBDBRv0500A


Bibliography
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function