Quick Search

Enter gene name or accession number


Search term: Rv0500

** Showing annotation for Rv0500. Did you mean: Rv0500A, Rv0500B


General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameproC
Rv numberRv0500
TypeCDS
FunctionInvolved at the terminal (third) step in proline biosynthesis [catalytic activity: L-proline + NAD(P)+ = 1-pyrroline-5-carboxylate + NAD(P)H].
ProductProbable pyrroline-5-carboxylate reductase ProC (P5CR) (P5C reductase)
CommentsRv0500, (MTCY20G9.26), len: 295 aa. Probable proC, Pyrroline-5-carboxylate reductase (see citation below), equivalent to P46725|PROC_MYCLE pyrroline-5-carboxylate reductase from Mycobacterium leprae (294 aa), FASTA scores: opt: 1473, E(): 0, (82.4% identity in 295 aa overlap). Also similar to others e.g. P46540|PROC_CORGL pyrroline-5-carboxylate reductase from Corynebacterium glutamicum (270 aa); T36286|4803683|CAB42663.1|AL049819 pyrroline-5-carboxylate reductase from Streptomyces coelicolor (284 aa); etc. Belongs to the pyrroline-5-carboxylate reductase family.
Molecular mass (Da)30171.6
Isoelectric point4.4181
Gene length (bp)888
Protein length295
Location (kb)590.083


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
see TB knockouts/mutants availability


Coordinates
TypeStartEndOrientation
CDS590083590970+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0500|proC
MLFGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVAERMPDRANYLAQTYSVLVTSAAD
AVENATFVVVAVKPADVEPVIADLANATAAAENDSAEQVFVTVVAGITIAYFESKLPAGT
PVVRAMPNAAALVGAGVTALAKGRFVTPQQLEEVSALFDAVGGVLTVPESQLDAVTAVSG
SGPAYFFLLVEALVDAGVGVGLSRQVATDLAAQTMAGSAAMLLERMEQDQGGANGELMGL
RVDLTASRLRAAVTSPGGTTAAALRELERGGFRMAVDAAVQAAKSRSEQLRITPE
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ11141


Orthologs/Cross-references
CDC1551MT0520
Enzyme Classification1.5.1.2
Gene Ontologypyrroline-5-carboxylate reductase activity
cytoplasm
proline biosynthetic process
oxidation reduction
M. bovisMb0511
M. lepraeML2430
M. marinumMMAR_0826
M. smegmatisMSMEG_0943
UniProtQ11141
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0500


Expression Data
TBDBRv0500


Bibliography
Parish T, Gordhan BG, McAdam RA, Duncan K, Mizrahi V, Stoker NG,
Production of mutants in amino acid biosynthesis genes of Mycobacterium tuberculosis by homologous recombination
Microbiology (1999) 145(Pt 12):3497-503
Cited for: Mutant
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG,
Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry.
J Proteome Res (2005) 4(3):855-61
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant