Quick Search

Enter gene name or accession number


Search term: Rv0499

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0499
Rv numberRv0499
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv0499, (MTCY20G9.25), len: 291 aa. Conserved hypothetical protein, showing some similarity to AL031184|SC2A11_16|T34762 hypothetical protein from Streptomyces coelicolor (340 aa), FASTA scores: opt: 240, E(): 1.8e-07, (28.9% identity in 270 aa overlap).
Molecular mass (Da)30670.3
Isoelectric point6.3898
Gene length (bp)876
Protein length291
Location (kb)589.183


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: intermediary metabolism and respiration (See Mazandu and Mulder, 2012)


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS589183590058+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0499|Rv0499
MNALFTTAMALRPLDSDPGNPACRVFEGELNEHWTIGPKVHGGAMVALCANAARTAYGAA
GQQPMRQPVAVSASFLWAPDPGTMRLVTSIRKRGRRISVADVELTQGGRTAVHAVVTLGE
PEHFLPGVDGSGGASGTAPLLSANPVVELMAPEPPEGVVPIGPGHQLAGLVHLGEGCDVR
PVLSTLRSATDGRPPVIQLWARPRGVAPDALFALLCGDLSAPVTFAVDRTGWAPTVALTA
YLRALPADGWLRVLCTCVEIGQDWFDEDHIVVDRLGRIVVQTRQLAMVPAQ
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT0519
Gene Ontologydiacylglycerol kinase activity
activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway
M. bovisMb0510
M. lepraeML2431
M. marinumMMAR_0825
M. smegmatisMSMEG_0942
UniProtP64719
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0499


Expression Data
TBDBRv0499


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function