Quick Search

Enter gene name or accession number


Search term: Rv0498

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0498
Rv numberRv0498
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv0498, (MTCY20G9.24), len: 280 aa. Conserved hypothetical protein, highly similar to P54581|Y498_MYCLE|ML2432 hypothetical 30.5 KDA protein from Mycobacterium leprae (280 aa); and S72896|B2168_C2_210 hypothetical protein from Mycobacterium leprae (244 aa), FASTA scores: opt: 1486, E():0, (89.3% identity in 244 aa overlap). Also similar to Q9X8H0|Y714_STRCO|SCE7.14c hypothetical protein from Streptomyces coelicolor.
Molecular mass (Da)30433.6
Isoelectric point8.1289
Gene length (bp)843
Protein length280
Location (kb)588.325


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: intermediary metabolism and respiration (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS588325589167+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0498|Rv0498
VRPAIKVGLSTASVYPLRAEAAFEYADRLGYDGVELMVWGESVSQDIDAVRKLSRRYRVP
VLSVHAPCLLISQRVWGANPILKLDRSVRAAEQLGAQTVVVHPPFRWQRRYAEGFSDQVA
ALEAASTVMVAVENMFPFRADRFFGAGQSRERMRKRGGGPGPAISAFAPSYDPLDGNHAH
YTLDLSHTATAGTDSLDMARRMGPGLVHLHLCDGSGLPADEHLVPGRGTQPTAEVCQMLA
GSGFVGHVVLEVSTSSARSANERESMLAESLQFARTHLLR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP64717


Orthologs/Cross-references
CDC1551MT0518
M. bovisMb0509
M. lepraeML2432
M. marinumMMAR_0824
M. smegmatisMSMEG_0941
UniProtP64717
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0498


Expression Data
TBDBRv0498


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function