Quick Search

Enter gene name or accession number


Search term: Rv0496

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0496
Rv numberRv0496
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv0496, (MTCY20G9.22), len: 328 aa. Conserved hypothetical protein, highly similar to S72894|467046|AAA17230.1|U00018 exopolyphosphatase ppx from Mycobacterium leprae (406 aa), FASTA scores: opt: 1902, E(): 0, (86.6% identity in 343 aa overlap); and P54882|Y496_MYCLE|ML2434|13094008|CAC31951.1|AL583925 hypothetical 36.2 KDA protein from Mycobacterium leprae (339 aa). Also highly similar to hypothetical proteins and exopolyphosphatases e.g. Q9X8H1|Y715_STRCO|SCE7.15c hypothetical protein from Streptomyces coelicolor (309 aa). C-terminal region similar to CGU31224_1|Q46054 protein similar to ppx gene product of Mycobacterium leprae from Cornybacterium glutamicum (140 aa), FASTA scores: opt: 615, E(): 2.7e-33, (70.9% identity in 134 aa overlap).
Molecular mass (Da)34843.5
Isoelectric point6.325
Gene length (bp)987
Protein length328
Location (kb)586.394


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: intermediary metabolism and respiration (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS586394587380+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0496|Rv0496
VVDAHRGGHPTPMSSTKATLRLAEATDSSGKITKRGADKLISTIDEFAKIAISSGCAELM
AFATSAVRDAENSEDVLSRVRKETGVELQALRGEDESRLTFLAVRRWYGWSAGRILNLDI
GGGSLEVSSGVDEEPEIALSLPLGAGRLTREWLPDDPPGRRRVAMLRDWLDAELAEPSVT
VLEAGSPDLAVATSKTFRSLARLTGAAPSMAGPRVKRTLTANGLRQLIAFISRMTAVDRA
ELEGVSADRAPQIVAGALVAEASMRALSIEAVEICPWALREGLILRKLDSEADGTALIES
SSVHTSVRAVGGQPADRNAANRSRGSKP
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP65786


Orthologs/Cross-references
CDC1551MT0516
Gene Ontologyhydrolase activity
M. bovisMb0507
M. lepraeML2434
M. marinumMMAR_0822
M. smegmatisMSMEG_0939
UniProtP65786
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0496


Expression Data
TBDBRv0496


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function