Quick Search

Enter gene name or accession number


Search term: Rv0494

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0494
Rv numberRv0494
TypeCDS
FunctionInvolved in transcriptional mechanism.
ProductProbable transcriptional regulatory protein (probably GntR-family)
CommentsRv0494, (MTCY20G9.20), len: 242 aa. Probable transcriptional regulator, GntR family, with C-terminal part highly similar to S72893|B2168_C2_205 hypothetical protein from Mycobacterium leprae (105 aa). Also similar to other transcription regulators e.g. PDHR_ECOLI|P06957 pyruvate dehydrogenase complex repressor PDHR or GENA from Escherichia coli (254 aa), FASTA scores: opt: 284, E(): 1.2e-11, (32.6% identity in 224 aa overlap); etc. Contains PS00043 Bacterial regulatory proteins, gntR family signature, and probable helix-turn helix motif from aa 50-71 (Score 1229, +3.37 SD).
Molecular mass (Da)25996.6
Isoelectric point5.6777
Gene length (bp)729
Protein length242
Location (kb)584.695


Functional categoryregulatory proteins


ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS584695585423+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0494|Rv0494
LVEPMNQSSVFQPPDRQRVDERIATTIADAILDGVFPPGSTLPPERDLAERLGVNRTSLR
QGLARLQQMGLIEVRHGSGSVVRDPEGLTHPAVVEALVRKLGPDFLVELLEIRAALGPLI
GRLAAARSTPEDAEALCAALEVVQQADTAAARQAADLAYFRVLIHSTRNRALGLLYRWVE
HAFGGREHALTGAYDDADPVLTDLRAINGAVLAGDPAAAAATVEAYLNASALRMVKSYRD
RA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP67739


Orthologs/Cross-references
CDC1551MT0514
Gene Ontologytranscription factor activity
intracellular
transcription
regulation of transcription, DNA-dependent
M. bovisMb0505
M. lepraeML2436
M. marinumMMAR_0820
M. smegmatisMSMEG_2173
MSMEG_2794
UniProtP67739
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0494


Expression Data
TBDBRv0494


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant