Quick Search

Enter gene name or accession number


Search term: Rv0493c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0493c
Rv numberRv0493c
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv0493c, (MTCY20G9.19), len: 329 aa. Conserved protein, showing some similarity to U00018_33|B2168_F2_93 from Mycobacterium leprae (167 aa), FASTA scores: opt: 166, E(): 0.00077, (35.9% identity in 131 aa overlap).
Molecular mass (Da)35395
Isoelectric point7.3854
Gene length (bp)990
Protein length329
Location (kb)583.701


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: regulatory proteins (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS583701584690-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0493c|Rv0493c
VGESTTQPAGGAAVDDETRSAALPRWRGAAGRLEVWYATLSDPLTRTGLWVHCETVAPTT
GGPYAHGWVTWFPPDAPPGTERFGPQPAQPAAGPAWFDIAGVRMAPAELTGRTRSLAWEL
SWKDTAAPLWTFPRVAWERELLPGAQVVIAPTAVFAGSLAVGETTHRVDSWRGSVAHIYG
HGNAKRWGWIHADLGDGDVLEVVTAVSHKPGLRRLAPLAFVRFRIDGKDWPASPLPSLRM
RTTLGVRHWQLEGRIGGREALIRVDQPPERCVSLGYTDPDGAKAVCTNTEQADIHIELGG
RHWSVLGTGHAEVGLRGTAAPAIKEGTPA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT0513
M. bovisMb0504c
M. lepraeML2437
M. marinumMMAR_0819
UniProtQ11158
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0493c


Expression Data
TBDBRv0493c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function