Quick Search

Enter gene name or accession number


Search term: Rv0492c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0492c
Rv numberRv0492c
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductProbable oxidoreductase GMC-type
CommentsRv0492c, (MT0511/MT0512, MTCY20G9.18c), len: 629 aa. Probable oxidoreductase GMC type, similar to others except in N-terminus e.g. P55582|AE000087_5|Y4NJ_RHISN hypothetical GMC-type oxidoreductase from Rhizobium sp. (505 aa), FASTA scores: opt: 873, E():0, (34.3% identity in 502 aa overlap); YTH2_RHOER|P46371 hypothetical 53.0 kDa GMC-type oxidoreductase from Rhodococcus erythropolis (493 aa), FASTA score: (25.7% identity in 521 aa overlap); YTH2_RHOSO|P46371 hypothetical 53.0 kDa gmc-type oxidoreductase from Rhodococcus erythropolis (493 aa), FASTA score: (25.7% identity in 521 aa overlap); NP_085596.1|NC_002679 probable oxidoreductase from Mesorhizobium loti (507 aa); NP_285451.1|NC_001264 GMC oxidoreductase from Deinococcus radiodurans (722 aa); NP_249055.1|NC_002516 probable oxidoreductase from Pseudomonas aeruginosa (531 aa); etc. Contains PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature, and PS00624 GMC oxidoreductases signature 2. Belongs to the GMC oxidoreductases family. Cofactor: FAD (by similarity). Note that start changed since first submission (previously 684 aa).
Molecular mass (Da)66154.2
Isoelectric point9.626
Gene length (bp)1890
Protein length629
Location (kb)581.489


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS581489583378-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0492c|Rv0492c
MSRLADRAKSYPLASFGAALLPPELGGPLPAQFVQRVDRYVTRLPATSRFAVRAGLASLA
AASYLTTGRSLPRLHPDERARVLHRIAALSPEVAAAVEGLKAIVLLANGADTYAHELLAR
AQEHDAARPDAELTVILSADSPSVTRADAVVVGSGAGGAMVARTLARAGLDVVVLEEGRR
WTVEEFRSTHPVDRYAGLYRGAGATVALGRPAVVLPMGRAVGGTTVVNSGTCFRPSLAVQ
RRWRDEFGLGLADPDQLGRRLDDAEQTLRVAPVPLEIMGRNGRLLLQAAKSLGWRAAPIP
RNAPGCRGCCQCAIGCPSNAKFGVHLNALPQACAAGARIISWARVERILHRAGRAYGVRA
RRPDGTTLDVLADAVVVAAGATETPGLLRRSGLGGHPRLGHNLALHPATMLAGLFDDDVF
AWRGVLQSAAVHEFHESDGVLIEATSTPPGMGSMVFPGYGAELLRWLDRAPQIATFGAMV
ADRGVGTVRSVRGETVVRYDIAPGEIAKLRVALQAIGRLLFAAGAVEVLTGIPGAPPMRS
LPELQDVLRRANPRSLHLAAFHPTGTAAAGADEQLCPVDATGRLRGVEGVWVADASILPS
CPEVNPQLSIMAMALAVADQTVAKVVGVR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ11157


Orthologs/Cross-references
CDC1551MT0511
MT0512
Enzyme Classification1.1.-.-
Gene Ontologyoxidoreductase activity, acting on CH-OH group of donors
FAD binding
oxidation reduction
M. bovisMb0502c
M. lepraeML2438
M. marinumMMAR_0817
M. smegmatisMSMEG_5967
UniProtQ11157
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0492c


Expression Data
TBDBRv0492c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG,
Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry.
J Proteome Res (2005) 4(3):855-61
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant