Quick Search

Enter gene name or accession number


Search term: Rv0492A

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0492A
Rv numberRv0492A
TypeCDS
FunctionUnknown
ProductHypothetical protein
CommentsRv0492A, len: 109 aa. Hypothetical unknown protein. GC plot suggests CDS.
Molecular mass (Da)12271.4
Isoelectric point11.1319
Gene length (bp)330
Protein length109
Location (kb)583.375


Functional categoryconserved hypotheticals


MutationNon-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS583375583704-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0492A|Rv0492A
MSFLLDPPLLFVCGVLIERRLPVDRRDAAEAAALGVFFGASFGLYHNVPGLGMLWRPFRA
QNGRDFMWNSGVFSVDVARAEWPLHAMAAAIFATYPFFIKLGRRLGRRI
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
M. bovisMb0503c
M. marinumMMAR_0818
UniProtQ6MX36
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0492A


Expression Data
TBDBRv0492A


Bibliography
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant