Quick Search

Enter gene name or accession number


Search term: Rv0490

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namesenX3
Rv numberRv0490
TypeCDS
FunctionSensor part of a two component regulatory system. Probably forms part of a two-component regulatory system SENX3/REGX3; phosphorylates REGX3.
ProductPutative two component sensor histidine kinase SenX3
CommentsRv0490, (MTCY20G9.16), len: 410 aa. Putative senX3, two-component sensor histidine kinase, transmembrane protein (see citations below), equivalent to O07129|SEX3_MYCBO sensor-like histidine kinase SENX3 from Mycobacterium bovis BCG (410 aa), FASTA scores: E(): 0, (99.5% identity in 410 aa overlap); and highly similar to P54883|SEX3_MYCLE|SENX3 sensor-like histidine kinase from Mycobacterium leprae (443 aa), FASTA score: (83.8% identity in 408 aa overlap). Also highly similar, except in N-terminus, to CAC31957.1|AL583925 probable two-component system sensor histidine kinase from Mycobacterium leprae (441 aa). Also highly similar to sensor kinase proteins from other organisms e.g. CAB77323.1|AL160331 putative sensor kinase protein from Streptomyces coelicolor (426 aa).
Molecular mass (Da)44792.7
Isoelectric point6.4423
Gene length (bp)1233
Protein length410
Location (kb)579.349


Functional categoryregulatory proteins


ProteomicsPredicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). M. tuberculosis H37Rv senX3-regX3 mutant has reduced ability to survive in THP-1 and bone-marrow-derived macrophages; mutant is attenuated in SCID and DBA/2 mice (See Parish et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS579349580581+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0490|senX3
VTVFSALLLAGVLSALALAVGGAVGMRLTSRVVEQRQRVATEWSGITVSQMLQCIVTLMP
LGAAVVDTHRDVVYLNERAKELGLVRDRQLDDQAWRAARQALGGEDVEFDLSPRKRSATG
RSGLSVHGHARLLSEEDRRFAVVFVHDQSDYARMEAARRDFVANVSHELKTPVGAMALLA
EALLASADDSETVRRFAEKVLIEANRLGDMVAELIELSRLQGAERLPNMTDVDVDTIVSE
AISRHKVAADNADIEVRTDAPSNLRVLGDQTLLVTALANLVSNAIAYSPRGSLVSISRRR
RGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVAANHDGTI
RVWSKPGTGSTFTLALPALIEAYHDDERPEQAREPELRSNRSQREEELSR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP0A600


Orthologs/Cross-references
CDC1551MT0509
Enzyme Classification2.7.13.3
Gene Ontologytwo-component sensor activity
two-component signal transduction system (phosphorelay)
ATP binding
plasma membrane
signal transduction
integral to membrane
peptidyl-histidine phosphorylation
M. bovisMb0500
M. lepraeML2440
M. marinumMMAR_0815
M. smegmatisMSMEG_0936
UniProtP0A600
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0490


Expression Data
TBDBRv0490


Bibliography
Himpens S, Locht C, Supply P,
Molecular characterization of the mycobacterial SenX3 -RegX3 two-component system: evidence for autoregulation
Microbiology (2000) 146:3091-3098
Cited for: Secondary/Regulation
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Parish T, Smith DA, Roberts G, Betts J, Stoker NG,
The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence.
Microbiology (Reading, Engl.) (2003) 149(Pt 6):1423-35
Cited for: Mutant/Regulation
Sassetti CM, Rubin EJ,
Genetic requirements for mycobacterial survival during infection.
Proc Natl Acad Sci U S A (2003) 100(22):12989-94
Cited for: Mutant
Malen H, Berven FS, Fladmark KE, Wiker HG,
Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
Proteomics (2007) 7(10):1702-18
Cited for: Proteomics
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Supply P, Magdalena J, Himpens S, Locht C,
Identification of novel intergenic repetitive units in a mycobacterial two -component system operon
Mol Microbiol (1997) 26(5):991-1003
Cited for: Sequence