Quick Search

Enter gene name or accession number


Search term: Rv0488

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0488
Rv numberRv0488
TypeCDS
FunctionUnknown; possibly involved in transport of lysine across the membrane.
ProductProbable conserved integral membrane protein
CommentsRv0488, (MTCY20G9.14), len: 201 aa. Probable conserved integral membrane protein, LysE family possibly involved in transport of Lysine, similar to others and conserved hypothetical proteins e.g. AB93746.1|AL357613 putative membrane transport protein from Streptomyces coelicolor (204 aa); D83100|PA4365 probable transporter from Pseudomonas aeruginosa (200 aa); YGGA_ECOLI|P11667 hypothetical 21.7 kDa protein from Escherichia coli (197 aa), FASTA scores: opt: 382, E(): 1.1e-19, (39.1% identity in 179 aa overlap); CGLYSEG_2 C|P94633 lysine exporter protein (236 aa), FASTA scores: E(): 2.3e-07, (33.3% identity in 219 aa overlap). Also similar to Rv1986 from Mycobacterium tuberculosis.
Molecular mass (Da)20950.9
Isoelectric point8.7563
Gene length (bp)606
Protein length201
Location (kb)577.664


Functional categorycell wall and cell processes


MutationNon-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS577664578269+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0488|Rv0488
MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVGGFAALIHAHPNMTLV
ARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCLVVTFLNPHVYLDTVVL
IGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFATPAAWRILDALVAVTMIG
VAVVVLVTSPSVPTANVALII
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP64711


Orthologs/Cross-references
CDC1551MT0507
Gene Ontologyplasma membrane
amino acid transport
integral to membrane
M. bovisMb0498
UniProtP64711
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0488


Expression Data
TBDBRv0488


Bibliography
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant