Quick Search

Enter gene name or accession number


Search term: Rv0487

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0487
Rv numberRv0487
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv0487, (MTCY20G9.13), len: 183 aa. Conserved hypothetical protein, highly similar to P54139|Y487_MYCLE|U00018_38|ML2442 hypothetical 20.8 KDA protein from Mycobacterium leprae (184 aa), FASTA scores: opt: 760, E(): 2.4 e-34, (73.0% identity in 159 aa overlap). Also highly similar to CAC04041.1|AL391406 conserved hypothetical protein from Streptomyces coelicolor (168 aa).
Molecular mass (Da)20684.5
Isoelectric point6.8026
Gene length (bp)552
Protein length183
Location (kb)576.787


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: intermediary metabolism and respiration (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS576787577338+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0487|Rv0487
VTSSLPTVQRVIQNALEVSQLKYSQHPRPGGAPPALIVELPGERKLKINTILSVGEHSVR
VEAFVCRKPDENREDVYRFLLRRNRRLYGVAYTLDNVGDIYLVGQMALSAVDADEVDRVL
GQVLEVVDSDFNALLELGFRSSIQREWQWRLSRGESLQNLQAFAHLRPTTMQSAQRDEKE
LGG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP64709


Orthologs/Cross-references
CDC1551MT0505
M. bovisMb0497
M. lepraeML2442
M. marinumMMAR_0813
M. smegmatisMSMEG_0934
UniProtP64709
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0487


Expression Data
TBDBRv0487


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function