|  |
| To navigate upstream or downstream, click on the first or last gene |
| Functional category | virulence, detoxification, adaptation |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE and MALDI-TOF-MS (See Sinha et al., 2005). Putative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutation | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation | CDS | 519600 | 520322 | + |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv|Rv0432|sodC MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGTTPSIWTGSPAPSGLS GHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTGVGKLTPGFHGLHIHQV GKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQVRGDGSAMLVTTTDAFT MDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG | ||
| Blastp: Pre-computed results | ||
| TransMembrane prediction using Hidden Markov Models: TMHMM | ||
| Genomic sequence | ||
| Structural information | ||
|---|---|---|
| PFAM | P0A608 | |
| Protein Data Bank | 1PZS | |
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT0447 | |
| Enzyme Classification | 1.15.1.1 | |
| Gene Ontology | superoxide dismutase activity plasma membrane superoxide metabolic process metal ion binding oxidation reduction | |
| M. bovis | Mb0440 | |
| M. leprae | ML1925 | |
| M. marinum | MMAR_0747 | |
| M. smegmatis | MSMEG_0835 | |
| UniProt | P0A608 | |
| Multiple Sequences Alignment: between orthologs | ||
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv0432 | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv0432 | |
| Bibliography | ||
|---|---|---|
| Sassetti CM, Boyd DH, Rubin EJ, Genes required for mycobacterial growth defined by high density mutagenesis. Mol Microbiol (2003) 48(1):77-84 Cited for: Mutant | ||
| Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X, Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol Cell Proteomics (2003) 2(12):1284-96 Cited for: Proteomics | ||
| Spagnolo L, Toro I, D'Orazio M, O'Neill P, Pedersen JZ, Carugo O, Rotilio G, Battistoni A, Djinovic-Carugo K, Unique features of the sodC-encoded superoxide dismutase from Mycobacterium tuberculosis, a fully functional copper-containing enzyme lacking zinc in the active site. J Biol Chem (2004) 279(32):33447-55 Cited for: Structure | ||
| Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG, Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J Proteome Res (2005) 4(3):855-61 Cited for: Proteomics | ||
| Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P, Cole ST, Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics. Microbiology (2005) 151(Pt 7):2411-9 Cited for: Proteomics | ||
| Gonzalez-Zamorano M, Mendoza-Hernandez G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C, Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. J Proteome Res (2009) 8(2):721-33 Cited for: Proteomics | ||
| Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG, Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. BMC Microbiol (2010) 10:132 Cited for: Proteomics | ||
| de Souza GA, Leversen NA, Malen H, Wiker HG, Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. J Proteomics (2011) 75(2):502-10 Cited for: Proteomics | ||
| Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM, High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. PLoS Pathog (2011) 7(9):e1002251 Cited for: Mutant | ||