Quick Search

Enter gene name or accession number


Search term: Rv0414c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namethiE
Rv numberRv0414c
TypeCDS
FunctionInvolved in thiamine biosynthesis. Condenses 4-methyl-5-(beta-hydroxyethyl)-thiazole monophosphate (THZ-P) and 4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-pp) to form thiamine monophosphate (TMP) [catalytic activity: 2-methyl-4-amino-5-hydroxymethylpyrimidine diphosphate + 4-4-methyl-5-(2-phosphonooxyethyl)-thiazole = diphosphate + thiamine monophosphate].
ProductThiamine-phosphate pyrophosphorylase ThiE (TMP pyrophosphorylase) (TMP-PPASE) (thiamine-phosphate synthase)
CommentsRv0414c, (MTCY22G10.11c), len: 222 aa. thiE, thiamin phosphate pyrophosphorylase, equivalent to Q9ZBL5|AL035159|MLCB1450_17 probable thiamine-phosphate pyrophosphorylase from Mycobacterium leprae (235 aa), FASTA scores: opt: 1095, E(): 0, (78.0% identity in 223 aa overlap). Also similar to others e.g. T34974|5689976|CAB52013.1|AL109663 probable thiamin phosphate pyrophosphorylase from Streptomyces coelicolor (223 aa); THIE_ECOLI|P30137 thie protein from Escherichia coli strain K12 (211 aa), FASTA scores: opt: 275, E(): 7.8e-12, (37.8% identity in 196 aa overlap); etc. Belongs to the TMP-PPASE family.
Molecular mass (Da)23239.3
Isoelectric point6.1205
Gene length (bp)669
Protein length222
Location (kb)500.35


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutationRequired for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS500350501018-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0414c|thiE
VHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKGSPGELRFGPLQARDE
LAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQRDLPVNVARQILAPDTLIGRS
THDPDQVAAAAAGDADYFCVGPCWPTPTKPGRAAPGLGLVRVAAELGGDDKPWFAIGGIN
AQRLPAVLDAGARRIVVVRAITSADDPRAAAEQLRSALTAAN
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMP66916
Protein Data Bank3O63


Orthologs/Cross-references
CDC1551MT0427
Enzyme Classification2.5.1.3
Gene Ontologymagnesium ion binding
thiamin-phosphate diphosphorylase activity
thiamin biosynthetic process
M. bovisMb0422c
M. lepraeML0300
M. marinumMMAR_0717
M. smegmatisMSMEG_0789
UniProtP66916
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0414c


Expression Data
TBDBRv0414c


Bibliography
Sassetti CM, Rubin EJ,
Genetic requirements for mycobacterial survival during infection.
Proc Natl Acad Sci U S A (2003) 100(22):12989-94
Cited for: Mutant
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant