Quick Search

Enter gene name or accession number


Search term: Rv0413

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namemutT3
Rv numberRv0413
TypeCDS
FunctionPossibly involved in the go system responsible for removing an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool. 8-oxo-dGTP is inserted opposite DA and DC residues of template DNA with almost equal efficiency thus leading to A.T to G.C transversions. MutT specifically degrades 8-oxo-dGTP to the monophosphate [catalytic activity: 8-oxo-dGTP + H2O = 8-oxo-dGMP + pyrophosphate].
ProductPossible mutator protein MutT3 (7,8-dihydro-8-oxoguanine-triphosphatase) (8-oxo-dGTPase) (dGTP pyrophosphohydrolase)
CommentsRv0413, (MTCY22G10.10), len: 217 aa. Possible mutT3, mutator protein (see citation below), showing some similarity with e.g. MUTT_PROVU|P32090 mutator mutt protein from Proteus vulgaris (112 aa), FASTA scores: opt: 151, E(): 0.0008, (40.7% identity in 59 aa overlap). Seems to belong to the NUDIX hydrolase family.
Molecular mass (Da)23481.2
Isoelectric point4.809
Gene length (bp)654
Protein length217
Location (kb)499.713


Functional categoryinformation pathways


ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS499713500366+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0413|mutT3
LPSCPPAYSEQVRGDGDGWVVSDSGVAYWGRYGAAGLLLRAPRPDGTPAVLLQHRALWSH
QGGTWGLPGGARDSHETPEQTAVRESSEEAGLSAERLEVRATVVTAEVCGVDDTHWTYTT
VVADAGELLDTVPNRESAELRWVAENEVADLPLHPGFAASWQRLRTAPATVPLARCDERR
QRLPRTIQIEAGVFLWCTPGDADQAPSPLGRRISSLL
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP96259


Orthologs/Cross-references
CDC1551MT0426
Enzyme Classification3.6.1.-
Gene OntologyDNA replication
DNA repair
hydrolase activity
metal ion binding
M. bovisMb0421
M. lepraeML0301
M. marinumMMAR_0716
M. smegmatisMSMEG_0790
UniProtP96259
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0413


Expression Data
TBDBRv0413


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Dos Vultos T, Blazquez J, Rauzier J, Matic I, Gicquel B,
Identification of Nudix hydrolase family members with an antimutator role in Mycobacterium tuberculosis and Mycobacterium smegmatis.
J Bacteriol (2006) 188(8):3159-61
Cited for: Biochemistry/Mutant
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mizrahi V, Andersen SJ,
DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence?
Mol Microbiol (1998) 29(6):1331-9
Cited for: Secondary/Function