Quick Search

Enter gene name or accession number


Search term: Rv0412c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0412c
Rv numberRv0412c
TypeCDS
FunctionUnknown
ProductPossible conserved membrane protein
CommentsRv0412c, (MTCY22G10.08c), len: 439 aa. Possible conserved membrane protein, equivalent to AL035159|MLCB1450_16|T44737 probable membrane protein from Mycobacterium leprae (403 aa), FASTA scores: opt: 2027, E(): 0, (80.4% identity in 403 aa overlap). Also some similarity with CAB71201.1|AL138538 putative secreted protein from Streptomyces coelicolor (429 aa).
Molecular mass (Da)47083.6
Isoelectric point10.1057
Gene length (bp)1320
Protein length439
Location (kb)498.3


Functional categorycell wall and cell processes


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) non essential gene by Himar1-based transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS498300499619-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0412c|Rv0412c
VTVELAHPSTEPLGSRSPAEPAHPRRWFISTTPGRIMTIGIVLAALGVASAFATSTTIEH
RQQVLTAVLDHTEPLSFAAGRLYTTLSVADAAAATAFIAQAEPGGVRLRYEQAITDASVA
VTRASSGLTDESLVQLLGRINAELAVYTGLVEIARANNRAGNPVGSSYLSEASGLMQSTI
LPDAQRLYQATSARVDRETTASTQIPAPVILVVATTVVFGAFAHRWLARRTRRRINPGLV
VGALGILVMVVWVGTALTISTTASRSAKDTAAESLKTITNLAITAQQARADETLSLIRRG
DEEVRKQAFYQRIDAMQRQLNDYMARRHAVDKPDLQGADQLLVRWRQANDRINSDISVGN
YRAATQVALGKGEDDATPAFDKLDEALTKAMGQSRTQLRHDILNAHRGLAGAQVGGVVLS
LGAAIAVALGLWPRLKEYR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT0425
M. bovisMb0420c
M. lepraeML0302
M. marinumMMAR_0715
M. smegmatisMSMEG_0788
UniProtP96258
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0412c


Expression Data
TBDBRv0412c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG,
Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry.
J Proteome Res (2005) 4(3):855-61
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant