Quick Search

Enter gene name or accession number


Search term: Rv0411c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameglnH
Rv numberRv0411c
TypeCDS
FunctionInvolved in active transport of glutamine across the membrane (import). Interacts with the glutamine-transport system.
ProductProbable glutamine-binding lipoprotein GlnH (GLNBP)
CommentsRv0411c, (MTCY22G10.07c), len: 328 aa. Probable glnH, glutamine-binding protein, membrane-bound lipoprotein (see citation below), equivalent to AL035159|MLCB1450_15|T44736|4154051|CAA22704.1 glutamine-binding protein homolog from Mycobacterium leprae (325 aa), FASTA scores: opt: 1747, E(): 0, (79.3% identity in 328 aa overlap). Also similar to others e.g. GLNH_BACST|P27676 glutamine-binding protein precursor from Bacillus stearothermophilus (262 aa), FASTA scores: opt: 493, E(): 7.5e-22, (37.8% identity in 193 aa overlap); etc. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site, PS01039 Bacterial extracellular solute-binding proteins, family 3 signature. Belongs to the bacterial extracellular solute-binding protein family 3. Presumed attached to the membrane by a lipid anchor.
Molecular mass (Da)35405.7
Isoelectric point5.2107
Gene length (bp)987
Protein length328
Location (kb)497.314


Functional categorycell wall and cell processes


ProteomicsPredicted surface lipoprotein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Putative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS497314498300-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0411c|glnH
MTRRALLARAAAPLAPLALAMVLASCGHSETLGVEATPTLPLPTPVGMEIMPPQPPLPPD
SSSQDCDPTASLRPFATKAEADAAVADIRARGRLIVGLDIGSNLFSFRDPITGEITGFDV
DIAGEVARDIFGVPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFSTVYL
DANQRILAPRDSPITKVSDLSGKRVCVARGTTSLRRIREIAPPPVIVSVVNWADCLVALQ
QREIDAVSTDDTILAGLVEEDPYLHIVGPDMADQPYGVGINLDNTGLVRFVNGTLERIRN
DGTWNTLYRKWLTVLGPAPAPPTPRYVD
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP96257


Orthologs/Cross-references
CDC1551MT0424
Gene Ontologytransporter activity
transport
outer membrane-bounded periplasmic space
M. bovisMb0419c
M. lepraeML0303
M. marinumMMAR_0714
M. smegmatisMSMEG_0787
UniProtP96257
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0411c


Expression Data
TBDBRv0411c


Bibliography
Braibant M, Gilot P, Content J,
The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis
FEMS Microbiol Rev (2000) 24(4):449-67
Cited for: Review/Secondary
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Malen H, Berven FS, Fladmark KE, Wiker HG,
Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
Proteomics (2007) 7(10):1702-18
Cited for: Proteomics
Gonzalez-Zamorano M, Mendoza-Hernandez G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C,
Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins.
J Proteome Res (2009) 8(2):721-33
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant