Quick Search

Enter gene name or accession number


Search term: Rv0409

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameackA
Rv numberRv0409
TypeCDS
FunctionInvolved at the first step (of two) in the conversion of acetate to acetyl-CoA [catalytic activity: ATP + acetate = ADP + acetyl phosphate].
ProductProbable acetate kinase AckA (acetokinase)
CommentsRv0409, (MTCY22G10.05), len: 385 aa. Probable ackA, acetate kinase, highly similar to others e.g. ACKA_BACSU|P37877 acetate kinase from Bacillus subtilis (395 aa), FASTA scores: opt: 974, E(): 0, (43.5% identity in 393 aa overlap); etc. Contains PS01075 Acetate and butyrate kinases family signature 1, PS00758 ArgE / dapE / ACY1/ CPG2 / yscS family signature 1. Belongs to the acetokinase family.
Molecular mass (Da)41318.2
Isoelectric point7.3064
Gene length (bp)1158
Protein length385
Location (kb)493.851


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS493851495008+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0409|ackA
MSSTVLVINSGSSSLKFQLVEPVAGMSRAAGIVERIGERSSPVADHAQALHRAFKMLAED
GIDLQTCGLVAVGHRVVHGGTEFHQPTLLDDTVIGKLEELSALAPLHNPPAVLGIKVARR
LLANVAHVAVFDTAFFHDLPPAAATYAIDRDVADRWHIRRYGFHGTSHQYVSERAAAFLG
RPLDGLNQIVLHLGNGASASAIARGRPVETSMGLTPLEGLVMGTRSGDLDPGVISYLWRT
ARMGVEDIESMLNHRSGMLGLAGERDFRRLRLVIETGDRSAQLAYEVFIHRLRKYLGAYL
AVLGHTDVVSFTAGIGENDAAVRRDALAGLQGLGIALDQDRNLGPGHGARRISSDDSPIA
VLVVPTNEELAIARDCLRVLGGRRA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP63409


Orthologs/Cross-references
CDC1551MT0422
Enzyme Classification2.7.2.1
Gene OntologyATP binding
cytoplasm
organic acid metabolic process
acetate kinase activity
phosphorylation
M. bovisMb0417
M. lepraeML0267
M. marinumMMAR_0711
M. smegmatisMSMEG_0784
UniProtP63409
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0409


Expression Data
TBDBRv0409


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant