Quick Search

Enter gene name or accession number


Search term: Rv0408

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namepta
Rv numberRv0408
TypeCDS
FunctionInvolved at the last step (of two) in the conversion of acetate to acetyl-CoA [catalytic activity: acetyl-CoA + phosphate = CoA + acetyl phosphate].
ProductProbable phosphate acetyltransferase Pta (phosphotransacetylase)
CommentsRv0408, (MTCY22G10.04), len: 690 aa. Probable pta, phosphate acetyltransferase, highly similar to others e.g. PTA_ECOLI|P39184|11279789|JX0357|B2297 phosphate acetyltransferase from Escherichia coli strain K12 (713 aa), FASTA scores: opt: 1303, E(): 0, (38.0% identity in 718 aa overlap); etc. Belongs to the phosphate acetyltransferase and butyryltransferase family.
Molecular mass (Da)72930.5
Isoelectric point5.0444
Gene length (bp)2073
Protein length690
Location (kb)491.786


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutation Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS491786493858+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0408|pta
LADSSAIYLAAPESQTGKSTIALGLLHRLTAMVAKVGVFRPITRLSAERDYILELLLAHT
SAGLPYERCVGVTYQQLHADRDDAIAEIVDSYHAMADECDAVVVVGSDYTDVTSPTELSV
NGRIAVNLGAPVLLTVRAKDRTPDQVASVVEVCLAELDTQRAHTAAVVANRCELSAIPAV
TDALRRFTPPSYVVPEEPLLSAPTVAELTQAVNGAVVSGDVALREREVMGVLAAGMTADH
VLERLTDGMAVITPGDRSDVVLAVASAHAAEGFPSLSCIVLNGGFQLHPAIAALVSGLRL
RLPVIATALGTYDTASAAASARGLVTATSQRKIDTALELMDRHVDVAGLLAQLTIPIPTV
TTPQMFTYRLLQQARSDLMRIVLPEGDDDRILKSAGRLLQRGIVDLTILGDEAKVRLRAA
ELGVDLDGATVIEPCASELHDQFADQYAQLRKAKGITVEHAREIMNDATYFGTMLVHNCH
ADGMVSGAAHTTAHTVRPALEIIKTVPGISTVSSIFLMCLPDRVLAYGDCAIIPNPTVEQ
LADIAICSARTAAQFGIEPRVAMLSYSTGDSGKGADVDKVRAATELVRAREPQLPVEGPI
QYDAAVEPSVAATKLRDSPVAGRATVLIFPDLNTGNNTYKAVQRSAGAIAIGPVLQGLRK
PVNDLSRGALVDDIVNTVAITAIQAQGVHE
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP96254


Orthologs/Cross-references
CDC1551MT0421
Enzyme Classification2.3.1.8
Gene Ontologycytoplasm
metabolic process
phosphate acetyltransferase activity
M. bovisMb0416
M. lepraeML0268
M. marinumMMAR_0710
M. smegmatisMSMEG_0783
UniProtP96254
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0408


Expression Data
TBDBRv0408


Bibliography
Malen H, Berven FS, Fladmark KE, Wiker HG,
Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
Proteomics (2007) 7(10):1702-18
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence