Quick Search

Enter gene name or accession number


Search term: Rv0407

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namefgd1
Rv numberRv0407
Synonym(s)fgd
TypeCDS
FunctionCatalyzes oxidation of glucose-6-phosphate to 6-phosphogluconolactone using coenzyme F420 (an *-hydroxy-5-deazaflavin derivative) as the electron acceptor.
ProductF420-dependent glucose-6-phosphate dehydrogenase Fgd1
CommentsRv0407, (MTCY22G10.03), len: 336 aa. fgd1, F420-dependent glucose-6-phosphate dehydrogenase, equivalent to others from Mycobacteria e.g. AAD38165.1|AF152394_3 from Mycobacterium avium (336 aa), FASTA scores: opt: 2082, E(): 0, (89.9% identity in 336 aa overlap); AL023514|MLCB 4_7 from Mycobacterium leprae (336 aa), FASTA scores: opt: 2069, E(): 0, (89.0% identity in 336 aa overlap). Also similar to other dehydrogenases e.g. CAA77276.1|Y18730 F420-dependent alcohol dehydrogenase from Methanofollis liminatans (330 aa). Also similar to many proteins from Mycobacterium tuberculosis e.g. Rv0953c, Rv0791c, etc. Note that previously known as fgd.
Molecular mass (Da)36956.8
Isoelectric point5.1301
Gene length (bp)1011
Protein length336
Location (kb)490.783


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by proteomics (See Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS490783491793+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0407|fgd1
VAELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAPFSLSWMTA
VGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLGVGTGEALNEIATGYEG
AWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPA
VAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSVDGIDKMIEIKISYDPDPE
LALNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAVEKVGQY
VTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRRLG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMP96253
Protein Data Bank3B4Y 3C8N


Orthologs/Cross-references
CDC1551MT0420
Enzyme Classification1.-.-.-
Gene Ontologyoxidoreductase activity
oxidation reduction
M. bovisMb0415
M. lepraeML0269
M. marinumMMAR_0709
M. smegmatisMSMEG_0777
UniProtP96253
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0407


Expression Data
TBDBRv0407


Bibliography
Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen P,
Towards the proteome of Mycobacterium tuberculosis
Electrophoresis (2000) 21(17):3740-56
Cited for: Proteomics
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG,
Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry.
J Proteome Res (2005) 4(3):855-61
Cited for: Proteomics
Bashiri G, Squire CJ, Moreland NJ, Baker EN,
Crystal structures of F420-dependent glucose-6-phosphate dehydrogenase FGD1 involved in the activation of the anti-tuberculosis drug candidate PA-824 reveal the basis of coenzyme and substrate binding.
J Biol Chem (2008) 283(25):17531-41
Cited for: Structure
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant