Quick Search

Enter gene name or accession number


Search term: Rv0406c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0406c
Rv numberRv0406c
TypeCDS
FunctionFunction unknown
ProductBeta lactamase like protein
CommentsRv0406c, (MTCY22G10.02c), len: 272 aa. Beta-lactamase-like protein, equivalent to AAD38170.1|AF152397_1 beta-lactamase-like protein from Mycobacterium phlei (243 aa); AL023514|MLCB4_8 hypothetical protein from Mycobacterium leprae (251 aa), FASTA scores: opt: 1284, E(): 0, (74.9% identity in 243 aa overlap); and AAD38164.1|AF152394_2 beta-lactamase-like protein from Mycobacterium avium (247 aa), FASTA scores: opt: 1301, E(): 0, (74.2% identity in 244 aa overlap); etc. Also slight similarity to others beta-lactamases and hypothetical proteins e.g. P52700|BLA1_XANMA|628530|S45349 metallo-beta-lactamase L1 precursor (beta-lactamase, type II) (penicillinase) from Xanthomonas maltophilia (290 aa), FASTA scores: (34.4% identity in 96 aa overlap). Recombinant protein has beta lactamase activity (See Nampoothiri et al., 2008).
Molecular mass (Da)29220.4
Isoelectric point8.3263
Gene length (bp)819
Protein length272
Location (kb)489.887


Functional categoryconserved hypotheticals


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS489887490705-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0406c|Rv0406c
MVATRGTRLAALALAPRLAGMAELVQITDKVHLARGHAVNWVLVTDDTGVLLIDAGYPGD
RAEVLASLNKLGYTPGDVRAIVLTHAHIDHLGSAIWFAREHSTPVYCHAEEVGHAKREYR
ENASVFDVALRSWRPRVAVWGIHLLRRGGLTGDGIPTAQPLTAEAAAGLPGQPMAIFTPG
HTSGHCSYVVDGVLASGDALITGHPMLRHRGPQLLPAVFSHSQQNSIRSLAALALLETNI
LAPGHGELWHGPIRKATDEALERAQKSNHVFR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT0419
Gene Ontologyhydrolase activity
M. bovisMb0414c
M. lepraeML0270
M. marinumMMAR_0708
M. smegmatisMSMEG_0775
UniProtO86336
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0406c


Expression Data
TBDBRv0406c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M, Small PM,
Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains.
Proc Natl Acad Sci U S A (2004) 101(14):4865-70
Cited for: Mutant
Nampoothiri KM, Rubex R, Patel AK, Narayanan SS, Krishna S, Das SM, Pandey A,
Molecular cloning, overexpression and biochemical characterization of hypothetical beta-lactamases of Mycobacterium tuberculosis H37Rv.
J Appl Microbiol (2008) 105(1):59-67
Cited for: Biochemistry
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant