| ![]() |
| To navigate upstream or downstream, click on the first or last gene | Download image in PDF format |
| Functional category | intermediary metabolism and respiration |
| Proteomics | Identified by proteomics at the Statens Serum Institute (Denmark) (see citation below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). |
| Mutation | non essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003) mutants available at TARGET website |
| Annotation Changes | proteomics updated on 01-APR-2009 |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation | CDS | 48233 | 49027 | - |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv | Rv0044c MTSLVRPDLPVRIGVQLQPQHAPHYRAVRDAVRRCEDIGVDIAFTWDHFFPLYGDPDGPHFECWTVLGAWAEQTSHIEIG ALVTCNSYRNPELLADMARTVDHISGGRLILGIGSGWKQKDYDEYGYRFGTAGSRLDDLAAALPRIKARLGKLNPPPTRD IPVLIGGGGERKTLRLVAEYADIWHSFTAGDSYLAKSAVLSTHCSTVGRNPATIERSAAVDGGGLIASAEALAGLGVTLL TVGCDGPDYDLSAAAALCRWRDGR | ||
| Blastp: results | ||
| TransMembrane prediction using Hidden Markov Models: tmhmm | ||
| Microbe Genome Browser | ||
| Genomic sequence | ||
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT0050 | |
| Enzyme Classification | 1.-.-.- | |
| Gene Ontology | oxidoreductase activity oxidation reduction | |
| Mbovis | Mb0045c | |
| Mleprae | ML2694 | |
| Msmegmatis | MSMEG_6907 | |
| UniProt | P71701 | |
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv0044c | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv0044c | |
| Bibliography | ||
|---|---|---|
| Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen P, Towards the proteome of Mycobacterium tuberculosis Electrophoresis (2000) 21(17):3740-56 | ||
| Sassetti CM, Boyd DH, Rubin EJ, Genes required for mycobacterial growth defined by high density mutagenesis. Mol Microbiol (2003) 48(1):77-84 | ||
| Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR, A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Proc Natl Acad Sci U S A (2003) 100 :7213 | ||
| Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X, Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol Cell Proteomics (2003) 2(12):1284-96 | ||