Quick Search

Enter gene name or accession number


Search term: Rv0039c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0039c
Rv numberRv0039c
TypeCDS
FunctionUnknown
ProductPossible conserved transmembrane protein
CommentsRv0039c, (MTCY21D4.02c, MTCY10H4.39c), len: 115 aa. Possible conserved transmembrane protein. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Molecular mass (Da)11292.3
Isoelectric point7.6885
Gene length (bp)348
Protein length115
Location (kb)42.004


Functional categorycell wall and cell processes


ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS4200442351-
RBS4235642360-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0039c|Rv0039c
MFLAGVLCMCAAAASALFGSWSLCHTPTADPTALALRAMAPTQLAAAVMLAAGGVVAVAA
PGHTALMVVIVCIAGAVGTLAAGSWQSAQYALRRETASPTANCVGSCAVCTQACH
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT0044
Gene Ontologyplasma membrane
integral to membrane
M. bovisMb0040c
M. lepraeML0030
M. marinumMMAR_0055
M. smegmatisMSMEG_6920
UniProtP71696
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0039c


Expression Data
TBDBRv0039c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST, Brosch R,
Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex.
Microbiology (2004) 150(Pt 2):483-96
Cited for: Homology
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics