Quick Search

Enter gene name or accession number


Search term: Rv0037c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0037c
Rv numberRv0037c
TypeCDS
FunctionUnknown; possibly involved in transport of macrolide across the membrane.
ProductProbable conserved integral membrane protein
CommentsRv0037c, (MTCY10H4.37c), len: 441 aa. Probable conserved integral membrane protein, member of major facilitator superfamily (MFS) possibly involved in transport of macrolide.
Molecular mass (Da)45834.1
Isoelectric point11.0182
Gene length (bp)1326
Protein length441
Location (kb)39.877


Functional categorycell wall and cell processes


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS3987741202-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0037c|Rv0037c
VPRVEVGLVIHSRMHARAPVDVWRSVRSLPDFWRLLQVRVASQFGDGLFQAGLAGALLFN
PDRAADPMAIAGAFAVLFLPYSLLGPFAGALMDRWDRRWVLVGANTGRLALIAGVGTILA
VGAGDVPLLVGALVANGLARFVASGLSAALPHVVPREQVVTMNSVAIASGAVSAFLGANF
MLLPRWLLGSGDEGASAIVFLVAIPVSIALLWSLRFGPRVLGPDDTERAIHGSAVYAVVT
GWLHGARTVVQLPTVAAGLSGLAAHRMVVGINSLLILLLVRHVTARAVGGLGTALLFFAA
TGLGAFLANVLTPTAIRRWGRYATANGALAAAATIQVAAAGLLVPVMVVCGFLLGVAGQV
VKLCADSAMQMDVDDALRGHVFAVQDALFWVSYILSITVAAALIPEHGHAPVFVLFGSAI
YLAGLVVHTIVGRRGQPVIGR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP0A5C1


Orthologs/Cross-references
CDC1551MT0042
Gene Ontologyplasma membrane
integral to membrane
transmembrane transport
M. bovisMb0038c
M. lepraeML0027
M. marinumMMAR_0052
M. smegmatisMSMEG_6922
UniProtP0A5C1
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0037c


Expression Data
TBDBRv0037c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Rengarajan J, Bloom BR, Rubin EJ,
Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages.
Proc Natl Acad Sci U S A (2005) 102(23):8327-32
Cited for: Mutant
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics