Quick Search

Enter gene name or accession number


Search term: Rv0036c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0036c
Rv numberRv0036c
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv0036c, (MTCY10H4.36c), len: 257 aa. Conserved protein, highly similar to CAB95889.1|AL359988 conserved hypothetical protein from Streptomyces (276 aa). Also some similarity to Rv3099c|MTCY164_10 (283 aa), FASTA scores: E(): 3.3e-05, (25.9% identity in 205 aa overlap).
Molecular mass (Da)27546.1
Isoelectric point4.633
Gene length (bp)774
Protein length257
Location (kb)39.056


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: cell wall and cell processes (See Mazandu and Mulder, 2012)


ProteomicsThe product of this CDS corresponds to spot 0036c identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark), and also at the Max Planck Institute for Infection Biology, Berlin, Germany (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS3905639829-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0036c|Rv0036c
MADPGPFVADLRAESDDLDALVAHLPADRWADPTPAPGWTIAHQIGHLLWTDRVALTAVT
DEAGFAELMTAAAANPAGFVDDAATELAAVSPAELLTDWRVTRGRLHEELLAVPDGRKLA
WFGPPMSAASMATARLMETWAHGLDVADALGVIRPATQRLRSIAHLGVRTRDYAFIVNNL
TPPAEPFLVELRGPSGDTWSWGPSDAAQRVTGSAEDFCFLVTQRRALSTLDVNAVGEDAQ
RWLTIAQAFAGPPGRGR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP64675


Orthologs/Cross-references
CDC1551MT0041
M. bovisMb0037c
M. marinumMMAR_0051
M. smegmatisMSMEG_6923
UniProtP64675
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0036c


Expression Data
TBDBRv0036c


Bibliography
Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Zimny -Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K, Kaufmann SH,
Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens
Mol Microbiol (1999) 33(6):1103-17
Cited for: Proteomics
Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen P,
Towards the proteome of Mycobacterium tuberculosis
Electrophoresis (2000) 21(17):3740-56
Cited for: Proteomics
Mattow J, Jungblut PR, Schaible UE, Mollenkopf HJ, Lamer S, Zimny-Arndt U, Zimny -Arndt U, Hagens K, Muller EC, Kaufmann SH,
Identification of proteins from Mycobacterium tuberculosis missing in attenuated Mycobacterium bovis BCG strains
Electrophoresis (2001) 22(14):2936-46
Cited for: Proteomics
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function