Quick Search

Enter gene name or accession number


Search term: Rv0034

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0034
Rv numberRv0034
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv0034, (MTCY10H4.34), len: 131 aa. Conserved hypothetical protein, showing weak similarity to AE001980|AE001980_7 hypothetical protein from Deinococcus radiodurans (120 aa), FASTA scores: opt: 141, E(): 0.0028, (29.3% identity in 123 aa overlap).
Molecular mass (Da)13967.7
Isoelectric point4.3189
Gene length (bp)396
Protein length131
Location (kb)36.867


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: lipid metabolism (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS3686737262+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0034|Rv0034
MTDDADLDLVRRTFAAFARGDLAELTQCFAPDVEQFVPGKHALAGVFRGVDNVVACLGDT
AAAADGTMTVTLEDVLSNTDGQVIAVYRLRASRAGKVLDQREAILVTVAGGRITRLSEFY
ADPAATESFWA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT0039
M. bovisMb0035
UniProtP64673
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0034


Expression Data
TBDBRv0034


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function