Quick Search

Enter gene name or accession number


Search term: Rv0033

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameacpA
Rv numberRv0033
Synonym(s)acpP
TypeCDS
FunctionKey component in de novo fatty acid biosynthesis. This protein is supposed to be the carrier of the growing fatty acid chain in fatty acid biosynthesis.
ProductProbable acyl carrier protein AcpA (ACP)
CommentsRv0033, (MTCY10H4.33), len: 87 aa. Probable acpA (alternate gene name: acpP), acyl carrier protein, similar to others. Also similar to proteins of Mycobacterium tuberculosis Rv1344 and Rv2244 (31.5% identity in 73 aa overlap).
Molecular mass (Da)9612.96
Isoelectric point4.357
Gene length (bp)264
Protein length87
Location (kb)36.607


Functional categorylipid metabolism


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS3660736870+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0033|acpA
MKEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFRDAQNIK
TVGDVYTSVAVWFPETAKPAPLGKGTA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMP71603
Protein Data Bank2CGQ


Orthologs/Cross-references
CDC1551MT0038
Gene Ontologyacyl carrier activity
cofactor binding
M. bovisMb0034
UniProtP71603
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0033


Expression Data
TBDBRv0033


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Huang Y, Ge J, Yao Y, Wang Q, Shen H, Wang H,
Characterization and site-directed mutagenesis of the putative novel acyl carrier protein Rv0033 and Rv1344 from Mycobacterium tuberculosis.
Biochem Biophys Res Commun (2006) 342(2):618-24
Cited for: Biochemistry/Function
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant