Quick Search

Enter gene name or accession number


Search term: Rv0032

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namebioF2
Rv numberRv0032
TypeCDS
FunctionCould be involved in biotin biosynthesis (at the first step) [catalytic activity: 6-carboxyhexanoyl-CoA + L-alanine = 8-amino-7-oxononanoate + CoA + CO2].
ProductPossible 8-amino-7-oxononanoate synthase BioF2 (AONS) (8-amino-7-ketopelargonate synthase) (7-keto-8-amino-pelargonic acid synthetase) (7-KAP synthetase) (L-alanine--pimelyl CoA ligase)
CommentsRv0032, (MTCY10H4.32), len: 771 aa. Probable bioF2, 8-amino-7-oxononanoate synthase, with its C-terminal similar to others. Contains PS00599 Aminotransferases class-II pyridoxal-phosphate attachment site. Belongs to class-II of pyridoxal-phosphate-dependent aminotransferases.
Molecular mass (Da)86243.3
Isoelectric point7.0184
Gene length (bp)2316
Protein length771
Location (kb)34.295


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS3429536610+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0032|bioF2
MPTGLGYDFLRPVEDSGINDLKHYYFMADLADGQPLGRANLYSVCFDLATTDRKLTPAWR
TTIKRWFPGFMTFRFLECGLLTMVSNPLALRSDTDLERVLPVLAGQMDQLAHDDGSDFLM
IRDVDPEHYQRYLDILRPLGFRPALGFSRVDTTISWSSVEEALGCLSHKRRLPLKTSLEF
RERFGIEVEELDEYAEHAPVLARLWRNVKTEAKDYQREDLNPEFFAACSRHLHGRSRLWL
FRYQGTPIAFFLNVWGADENYILLEWGIDRDFEHYRKANLYRAALMLSLKDAISRDKRRM
EMGITNYFTKLRIPGARVIPTIYFLRHSTDPVHTATLARMMMHNIQRPTLPDDMSEEFCR
WEERIRLDQDGLPEHDIFRKIDRQHKYTGLKLGGVYGFYPRFTGPQRSTVKAAELGEIVL
LGTNSYLGLATHPEVVEASAEATRRYGTGCSGSPLLNGTLDLHVSLEQELACFLGKPAAV
LCSTGYQSNLAAISALCESGDMIIQDALNHRSLFDAARLSGADFTLYRHNDMDHLARVLR
RTEGRRRIIVVDAVFSMEGTVADLATIAELADRHGCRVYVDESHALGVLGPDGRGASAAL
GVLARMDVVMGTFSKSFASVGGFIAGDRPVVDYIRHNGSGHVFSASLPPAAAAATHAALR
VSRREPDRRARVLAAAEYMATGLARQGYQAEYHGTAIVPVILGNPTVAHAGYLRLMRSGV
YVNPVAPPAVPEERSGFRTSYLADHRQSDLDRALHVFAGLAEDLTPQGAAL
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP71602


Orthologs/Cross-references
CDC1551MT0037
Enzyme Classification2.3.1.47
Gene Ontologyacyltransferase activity
transaminase activity
8-amino-7-oxononanoate synthase activity
biosynthetic process
ligase activity
pyridoxal phosphate binding
M. bovisMb0033
UniProtP71602
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0032


Expression Data
TBDBRv0032


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant