Quick Search

Enter gene name or accession number


Search term: Rv0031

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv0031
Rv numberRv0031
TypeCDS
FunctionNormally, required for the transposition of an insertion element.
ProductPossible remnant of a transposase
CommentsRv0031, (MTCY10H4.31), len: 70 aa. Possible remnant of a transposase, showing partial similarity to mycobacterial transposases in a short overlap, e.g. Rv2791c|MTV002_57 (459 aa), FASTA score: (72.2% identity in 36 aa overlap); Rv2885c, Rv2978c, Rv3827c, etc.
Molecular mass (Da)7432.46
Isoelectric point11.8653
Gene length (bp)213
Protein length70
Location (kb)33.582


Functional categoryinsertion seqs and phages


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS3358233794+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0031|Rv0031
LLARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFARIGHTSHPSTRKSRV
GPGASEAPLA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT0035
M. bovisMb0032
UniProtP71601
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0031


Expression Data
TBDBRv0031


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant