|  |
| To navigate upstream or downstream, click on the first or last gene | Download image in PDF format |
| Functional category | conserved hypotheticals |
| Mutation | non essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003) mutants available at TARGET website |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation | CDS | 29245 | 29607 | + |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv | Rv0025 MSEQAGSSVAVIQERQALLARQHDAVAEADRELADVLASAHAAMRESVRRLDAIAAELDRAVPDQDQLAVDTPMGAREFQ TFLVAKQREIVAVVAAAHELDRAKSAVLKRLRAQYTEPAR | ||
| Blastp: results | ||
| TransMembrane prediction using Hidden Markov Models: tmhmm | ||
| Microbe Genome Browser | ||
| Genomic sequence | ||
| Structural information | ||
|---|---|---|
| Protein Data Bank | No structure available | |
| PFAM | Protein Family Domains | |
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT0028 | |
| Mbovis | Mb0026 | |
| Mmarinum | MMAR_0044 | |
| UniProt | P71595 | |
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv0025 | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv0025 | |
| Bibliography | ||
|---|---|---|
| Sassetti CM, Boyd DH, Rubin EJ, Genes required for mycobacterial growth defined by high density mutagenesis. Mol Microbiol (2003) 48(1):77-84 | ||
| Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR, A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Proc Natl Acad Sci U S A (2003) 100 :7213 | ||