| ![]() |
| To navigate upstream or downstream, click on the first or last gene | Download image in PDF format |
| Functional category | cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). |
| Transcriptome | mRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see Betts et al., 2002). |
| Annotation Changes | proteomics updated on 01-APR-2009 |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation | CDS | 9914 | 10828 | + |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv | Rv0007 MTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPPWQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADA RLNRFISGASAPVTGPAAAVRTPQPDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAG SSGGRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAFLYLVLGGMGVWAKLNSNV GDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATIGAFVYNLITDLIGGIEVTLADRD | ||
| Blastp: results | ||
| TransMembrane prediction using Hidden Markov Models: tmhmm | ||
| Microbe Genome Browser | ||
| Genomic sequence | ||
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT0007 | |
| Gene Ontology | plasma membrane integral to membrane | |
| Mbovis | Mb0007 | |
| Mleprae | ML0007 | |
| Msmegmatis | MSMEG_0007 | |
| UniProt | P71575 | |
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv0007 | |
| Bibliography | ||
|---|---|---|
| Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K, Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling Mol Microbiol (2002) 43 :717 | ||
| Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST, Brosch R, Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Microbiology (2004) 150 (Pt 2):483-96 | ||
| Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG, Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J Proteome Res (2005) 4:855 | ||