BLASTP 2.2.25+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
           15,229,318 sequences; 5,219,829,388 total letters



Query= Rv0410c

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gi|289552659|ref|ZP_06441869.1|  serine/threonine-protein kinase ...  1523    0.0  
gi|15607551|ref|NP_214924.1|  serine/threonine-protein kinase PKN...  1523    0.0  
gi|289572995|ref|ZP_06453222.1|  serine/threonine-protein kinase ...  1522    0.0  
gi|15839796|ref|NP_334833.1|  serine/threonine protein kinase [My...  1522    0.0  
gi|306806217|ref|ZP_07442885.1|  serine/threonine-protein kinase ...  1521    0.0  
gi|289445949|ref|ZP_06435693.1|  serine/threonine-protein kinase ...  1521    0.0  
gi|340625435|ref|YP_004743887.1|  serine/threonine-protein kinase...  1521    0.0  
gi|308377415|ref|ZP_07479074.2|  serine/threonine-protein kinase ...  1520    0.0  
gi|289752439|ref|ZP_06511817.1|  serine/threonine-protein kinase ...  1520    0.0  
gi|289441789|ref|ZP_06431533.1|  serine/threonine-protein kinase ...  1520    0.0  
gi|254549355|ref|ZP_05139802.1|  serine/threonine protein kinase ...  1380    0.0  
gi|157835816|pdb|2PZI|A  Chain A, Crystal Structure Of Protein Ki...  1375    0.0  
gi|240168876|ref|ZP_04747535.1|  serine/threonine-protein kinase ...  1321    0.0  
gi|183980736|ref|YP_001849027.1|  serine/threonine-protein kinase...  1306    0.0  
gi|118618244|ref|YP_906576.1|  serine/threonine-protein kinase Pk...  1285    0.0  
gi|342859110|ref|ZP_08715764.1|  serine/threonine protein kinase ...  1270    0.0  
gi|336460366|gb|EGO39266.1|  serine/threonine protein kinase [Myc...  1270    0.0  
gi|41409991|ref|NP_962827.1|  PknG [Mycobacterium avium subsp. pa...  1269    0.0  
gi|254777190|ref|ZP_05218706.1|  serine/threonine protein kinase ...  1268    0.0  
gi|254818983|ref|ZP_05223984.1|  PknG [Mycobacterium intracellula...  1268    0.0  
gi|118463342|ref|YP_883878.1|  serine/threonine protein kinase [M...  1265    0.0  
gi|296167868|ref|ZP_06850051.1|  non-specific serine/threonine pr...  1262    0.0  
gi|15827075|ref|NP_301338.1|  serine-threonine protein kinase [My...  1242    0.0  
gi|15214184|sp|P57993.2|PKNG_MYCLE  RecName: Full=Probable serine...  1240    0.0  
gi|120401718|ref|YP_951547.1|  protein kinase [Mycobacterium vanb...  1204    0.0  
gi|108797520|ref|YP_637717.1|  serine/threonine protein kinase [M...  1200    0.0  
gi|315442240|ref|YP_004075119.1|  serine/threonine protein kinase...  1199    0.0  
gi|145220807|ref|YP_001131485.1|  protein kinase [Mycobacterium g...  1198    0.0  
gi|118468912|ref|YP_885191.1|  serine/threonine protein kinase [M...  1197    0.0  
gi|126433142|ref|YP_001068833.1|  serine/threonine protein kinase...  1197    0.0  
gi|289748895|ref|ZP_06508273.1|  serine/threonine protein kinase ...  1170    0.0  
gi|333989021|ref|YP_004521635.1|  serine/threonine-protein kinase...  1166    0.0  
gi|289756479|ref|ZP_06515857.1|  serine/threonine-protein kinase ...  1109    0.0  
gi|169631302|ref|YP_001704951.1|  serine/threonine-protein kinase...  1102    0.0  
gi|339297106|gb|AEJ49216.1|  serine/threonine protein kinase [Myc...  1095    0.0  
gi|111019188|ref|YP_702160.1|  serine/threonine-protein kinase [R...   790    0.0  
gi|226361324|ref|YP_002779102.1|  serine/threonine protein kinase...   781    0.0  
gi|229493048|ref|ZP_04386843.1|  serine/threonine protein kinase ...   776    0.0  
gi|226304963|ref|YP_002764921.1|  serine/threonine protein kinase...   775    0.0  
gi|111020581|ref|YP_703553.1|  serine/threonine-protein kinase [R...   719    0.0  
gi|333918206|ref|YP_004491787.1|  serine/threonine-protein kinase...   716    0.0  
gi|262204221|ref|YP_003275429.1|  serine/threonine protein kinase...   705    0.0  
gi|312141244|ref|YP_004008580.1|  serine/threonine kinase [Rhodoc...   704    0.0  
gi|325673925|ref|ZP_08153615.1|  non-specific serine/threonine pr...   703    0.0  
gi|343924492|ref|ZP_08764041.1|  serine/threonine protein kinase ...   702    0.0  
gi|296141429|ref|YP_003648672.1|  serine/threonine protein kinase...   699    0.0  
gi|226362802|ref|YP_002780580.1|  serine/threonine protein kinase...   699    0.0  
gi|326384624|ref|ZP_08206302.1|  serine/threonine protein kinase-...   672    0.0  
gi|317509499|ref|ZP_07967112.1|  serine/threonine protein kinase ...   663    0.0  
gi|296392569|ref|YP_003657453.1|  serine/threonine protein kinase...   652    0.0  


>gi|289552659|ref|ZP_06441869.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
KZN 605]
 gi|289437291|gb|EFD19784.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
KZN 605]
Length=751

 Score = 1523 bits (3944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 750/750 (100%), Positives = 750/750 (100%), Gaps = 0/750 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  2    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  61

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  62   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  121

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  122  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  181

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  182  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  241

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  242  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  301

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  302  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  361

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  362  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  421

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  422  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  481

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  482  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  541

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
Sbjct  542  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  601

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
Sbjct  602  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  661

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
Sbjct  662  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  721

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Sbjct  722  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  751


>gi|15607551|ref|NP_214924.1| serine/threonine-protein kinase PKNG (protein kinase G) (STPK 
G) [Mycobacterium tuberculosis H37Rv]
 gi|31791588|ref|NP_854081.1| serine/threonine-protein kinase PKNG (protein kinase G) (STPK 
G) [Mycobacterium bovis AF2122/97]
 gi|121636324|ref|YP_976547.1| Serine/threonine-protein kinase pknG [Mycobacterium bovis BCG 
str. Pasteur 1173P2]
 35 more sequence titles
 Length=750

 Score = 1523 bits (3942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 750/750 (100%), Positives = 750/750 (100%), Gaps = 0/750 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
Sbjct  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
Sbjct  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
Sbjct  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Sbjct  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750


>gi|289572995|ref|ZP_06453222.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
K85]
 gi|339630479|ref|YP_004722121.1| Ser/Thr protein kinase [Mycobacterium africanum GM041182]
 gi|289537426|gb|EFD42004.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
K85]
 gi|339329835|emb|CCC25484.1| serine/threonine-protein kinase PknG (protein kinase G) (STPK 
G) [Mycobacterium africanum GM041182]
Length=750

 Score = 1522 bits (3940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/750 (99%), Positives = 749/750 (99%), Gaps = 0/750 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
Sbjct  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
Sbjct  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
Sbjct  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQRHRY LVDMANKVRPTSTF
Sbjct  721  LRSLARVAPTQRHRYKLVDMANKVRPTSTF  750


>gi|15839796|ref|NP_334833.1| serine/threonine protein kinase [Mycobacterium tuberculosis CDC1551]
 gi|254230762|ref|ZP_04924089.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
C]
 gi|308231544|ref|ZP_07412841.2| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
SUMu001]
 18 more sequence titles
 Length=769

 Score = 1522 bits (3940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 750/750 (100%), Positives = 750/750 (100%), Gaps = 0/750 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  20   MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  79

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  80   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  139

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  140  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  199

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  200  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  259

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  260  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  319

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  320  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  379

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  380  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  439

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  440  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  499

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  500  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  559

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
Sbjct  560  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  619

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
Sbjct  620  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  679

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
Sbjct  680  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  739

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Sbjct  740  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  769


>gi|306806217|ref|ZP_07442885.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
SUMu007]
 gi|308347231|gb|EFP36082.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
SUMu007]
Length=750

 Score = 1521 bits (3938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/750 (99%), Positives = 750/750 (100%), Gaps = 0/750 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLA+VVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  181  KGLVHSGDAEAQAMAMAERQFLADVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
Sbjct  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
Sbjct  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
Sbjct  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Sbjct  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750


>gi|289445949|ref|ZP_06435693.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
CPHL_A]
 gi|289418907|gb|EFD16108.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
CPHL_A]
Length=750

 Score = 1521 bits (3938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/750 (99%), Positives = 749/750 (99%), Gaps = 0/750 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
Sbjct  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
Sbjct  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDA RRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
Sbjct  661  IRDATRRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Sbjct  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750


>gi|340625435|ref|YP_004743887.1| serine/threonine-protein kinase PKNG [Mycobacterium canettii 
CIPT 140010059]
 gi|340003625|emb|CCC42748.1| serine/threonine-protein kinase PKNG (protein kinase G) (STPK 
G) [Mycobacterium canettii CIPT 140010059]
Length=750

 Score = 1521 bits (3937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 748/750 (99%), Positives = 749/750 (99%), Gaps = 0/750 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            YRAVAELLTGDYDSAT+HFTEVLDTFPGELAPKLALAAT ELAGNTDEHKFYQTVWSTND
Sbjct  541  YRAVAELLTGDYDSATRHFTEVLDTFPGELAPKLALAATVELAGNTDEHKFYQTVWSTND  600

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
Sbjct  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
Sbjct  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Sbjct  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750


>gi|308377415|ref|ZP_07479074.2| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
SUMu009]
 gi|308355812|gb|EFP44663.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
SUMu009]
Length=769

 Score = 1520 bits (3936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/750 (99%), Positives = 750/750 (100%), Gaps = 0/750 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  20   MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  79

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  80   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  139

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  140  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  199

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLA+VVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  200  KGLVHSGDAEAQAMAMAERQFLADVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  259

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  260  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  319

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  320  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  379

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  380  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  439

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  440  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  499

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  500  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  559

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
Sbjct  560  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  619

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
Sbjct  620  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  679

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
Sbjct  680  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  739

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Sbjct  740  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  769


>gi|289752439|ref|ZP_06511817.1| serine/threonine-protein kinase pkng [Mycobacterium tuberculosis 
EAS054]
 gi|289693026|gb|EFD60455.1| serine/threonine-protein kinase pkng [Mycobacterium tuberculosis 
EAS054]
Length=750

 Score = 1520 bits (3936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/750 (99%), Positives = 749/750 (99%), Gaps = 0/750 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPG IVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  121  KGASEGWCPYCGSPYSFLPQLNPGHIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
Sbjct  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
Sbjct  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
Sbjct  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Sbjct  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750


>gi|289441789|ref|ZP_06431533.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
T46]
 gi|289414708|gb|EFD11948.1| serine/threonine-protein kinase pknG [Mycobacterium tuberculosis 
T46]
Length=750

 Score = 1520 bits (3935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/750 (99%), Positives = 749/750 (99%), Gaps = 0/750 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
Sbjct  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
Sbjct  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILG PFTSHGLRLGVEAS
Sbjct  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGSPFTSHGLRLGVEAS  720

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Sbjct  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750


>gi|254549355|ref|ZP_05139802.1| serine/threonine protein kinase [Mycobacterium tuberculosis '98-R604 
INH-RIF-EM']
Length=750

 Score = 1380 bits (3573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 718/750 (96%), Positives = 719/750 (96%), Gaps = 0/750 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVG                         P  
Sbjct  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGTHARGAHAGPAHPQWPLCGWATRRRPGA  360

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            +    YGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  361  ENLRLYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
Sbjct  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ
Sbjct  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS
Sbjct  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQRHRYTLVDMANKVRPTSTF
Sbjct  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750


>gi|157835816|pdb|2PZI|A Chain A, Crystal Structure Of Protein Kinase Pkng From Mycobacterium 
Tuberculosis In Complex With Tetrahydrobenzothiophene 
Ax20017
 gi|157835817|pdb|2PZI|B Chain B, Crystal Structure Of Protein Kinase Pkng From Mycobacterium 
Tuberculosis In Complex With Tetrahydrobenzothiophene 
Ax20017
Length=681

 Score = 1375 bits (3559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 677/677 (100%), Positives = 677/677 (100%), Gaps = 0/677 (0%)

Query  74   LGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYCGS  133
            LGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYCGS
Sbjct  5    LGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYCGS  64

Query  134  PYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQA  193
            PYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQA
Sbjct  65   PYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQA  124

Query  194  MAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKLPVAEA  253
            MAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKLPVAEA
Sbjct  125  MAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKLPVAEA  184

Query  254  IAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQ  313
            IAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQ
Sbjct  185  IAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQ  244

Query  314  APEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRA  373
            APEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRA
Sbjct  245  APEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRA  304

Query  374  IDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDV  433
            IDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDV
Sbjct  305  IDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDV  364

Query  434  YLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDA  493
            YLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDA
Sbjct  365  YLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDA  424

Query  494  DGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYD  553
            DGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYD
Sbjct  425  DGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYD  484

Query  554  SATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARAR  613
            SATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARAR
Sbjct  485  SATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARAR  544

Query  614  SAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPP  673
            SAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPP
Sbjct  545  SAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPP  604

Query  674  TEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRH  733
            TEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRH
Sbjct  605  TEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRH  664

Query  734  RYTLVDMANKVRPTSTF  750
            RYTLVDMANKVRPTSTF
Sbjct  665  RYTLVDMANKVRPTSTF  681


>gi|240168876|ref|ZP_04747535.1| serine/threonine-protein kinase PknG [Mycobacterium kansasii 
ATCC 12478]
Length=778

 Score = 1321 bits (3419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 649/745 (88%), Positives = 694/745 (94%), Gaps = 4/745 (0%)

Query  10   SGPGTQP---ADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGP-DTEPQDRMATTS  65
            + PG++P   AD QT  +A  RP +TQA+FRPDF D+D+    +LG  DT+PQ+RM+  +
Sbjct  34   AAPGSRPLQSADVQTGAAAGSRPPATQAIFRPDFDDDDDDLPISLGAMDTQPQERMSAAT  93

Query  66   RVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASE  125
            R  PP+R+LGGGLVEIPR PDIDPL+ALMT+PVVPESKRFCWNCGRPVGRSD+E  GASE
Sbjct  94   RALPPIRKLGGGLVEIPRVPDIDPLKALMTDPVVPESKRFCWNCGRPVGRSDAEGTGASE  153

Query  126  GWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVH  185
            GWCPYCGSPYSFLPQL  GDI+AGQYEVKGCIAHGG+GW+YLALD NVN RPVVLKGLVH
Sbjct  154  GWCPYCGSPYSFLPQLCAGDIIAGQYEVKGCIAHGGMGWVYLALDHNVNDRPVVLKGLVH  213

Query  186  SGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKG  245
            SGDAEAQA+AMAER+FLAEVVHPSIVQIFNFVEHTDR GDPVGYIVMEY+GGQSL+R +G
Sbjct  214  SGDAEAQAIAMAERKFLAEVVHPSIVQIFNFVEHTDRQGDPVGYIVMEYIGGQSLRRGRG  273

Query  246  QKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGY  305
            +KLPVAEAIAY+LEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGY
Sbjct  274  EKLPVAEAIAYILEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGY  333

Query  306  LYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDS  365
            LYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL+LPTRNGRY DGLP+DDPVL  YDS
Sbjct  334  LYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLNLPTRNGRYADGLPDDDPVLDKYDS  393

Query  366  YGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVD  425
            +GRLLRRAIDPDPR+RF + EEMSAQLTGVLREVVA DTGVPRPGLSTIFSPSRSTFGVD
Sbjct  394  FGRLLRRAIDPDPRRRFASTEEMSAQLTGVLREVVAADTGVPRPGLSTIFSPSRSTFGVD  453

Query  426  LLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRA  485
            LLVAHTDVYLDGQVHAEKLTA EIVTAL VPLVDPTDVAA VLQATVLSQPVQTLDSLRA
Sbjct  454  LLVAHTDVYLDGQVHAEKLTAKEIVTALQVPLVDPTDVAAPVLQATVLSQPVQTLDSLRA  513

Query  486  ARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVA  545
            ARHGALDA+GVD SESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRL+WY+AVA
Sbjct  514  ARHGALDAEGVDLSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLIWYKAVA  573

Query  546  ELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISA  605
            ELLTGDYDSA KHFTEVLDTFPGELAPKLAL ATAELAG TDEH FYQTVW TNDGVISA
Sbjct  574  ELLTGDYDSAIKHFTEVLDTFPGELAPKLALGATAELAGYTDEHNFYQTVWQTNDGVISA  633

Query  606  AFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAA  665
            AFGLARA SA+GDR GAVRTLDEVPP+SRHFTTARLTSAVTLLSGRS  E+TEEQIRDAA
Sbjct  634  AFGLARALSAKGDRAGAVRTLDEVPPSSRHFTTARLTSAVTLLSGRSQGEITEEQIRDAA  693

Query  666  RRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLA  725
            RRVE+LPPTEPRVLQIRALVLGGA+DWL+DN+ASTNHILGFPFT HGLRLGVEA+LRSLA
Sbjct  694  RRVESLPPTEPRVLQIRALVLGGAMDWLQDNQASTNHILGFPFTDHGLRLGVEAALRSLA  753

Query  726  RVAPTQRHRYTLVDMANKVRPTSTF  750
            R+APTQRHRYTLVDMAN VRPTSTF
Sbjct  754  RIAPTQRHRYTLVDMANNVRPTSTF  778


>gi|183980736|ref|YP_001849027.1| serine/threonine-protein kinase PknG [Mycobacterium marinum M]
 gi|183174062|gb|ACC39172.1| serine/threonine-protein kinase PknG [Mycobacterium marinum M]
Length=767

 Score = 1306 bits (3381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/748 (88%), Positives = 697/748 (94%), Gaps = 2/748 (0%)

Query  4    ASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGP-DTEPQDRMA  62
            A + + +GPGTQPAD QT  +A  RP+ TQA+FRP+F D+D     TLG  D +PQ  +A
Sbjct  21   AEDEQEAGPGTQPADVQTGAAAWSRPIGTQALFRPNFDDDDED-DITLGTLDMQPQGPLA  79

Query  63   TTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKG  122
              +R R PVRRLGGGLVEIPR PD DPL+ALMT+PVVPE+KRFCWNCGRPVGRSDSETKG
Sbjct  80   AATRARLPVRRLGGGLVEIPRVPDTDPLKALMTDPVVPEAKRFCWNCGRPVGRSDSETKG  139

Query  123  ASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKG  182
            ASEGWCPYCGSPYSFLPQL+PGD +AGQYEVKGCIAHGG+GWIYLALDRNVN RPVVLKG
Sbjct  140  ASEGWCPYCGSPYSFLPQLSPGDTIAGQYEVKGCIAHGGMGWIYLALDRNVNDRPVVLKG  199

Query  183  LVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKR  242
            LVHSGDAEAQA+AMAERQFLAEVVHPSIVQIFNFVEHTD+HGDPVGYIVMEYVGG+SLKR
Sbjct  200  LVHSGDAEAQAIAMAERQFLAEVVHPSIVQIFNFVEHTDKHGDPVGYIVMEYVGGRSLKR  259

Query  243  SKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINS  302
             KG+KLPV+EAIAYLLEILPAL+YLH++GLVYNDLKPENIMLTEEQLKLIDLGAVSRINS
Sbjct  260  RKGEKLPVSEAIAYLLEILPALAYLHALGLVYNDLKPENIMLTEEQLKLIDLGAVSRINS  319

Query  303  FGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKT  362
            FGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL+LPTRNGRY+DGLP+DDPVL +
Sbjct  320  FGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLNLPTRNGRYLDGLPDDDPVLAS  379

Query  363  YDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTF  422
            YDS+GRLLRRAIDPDPR+RF +AEEMS QL GVLREVVAQDTGVPRPGLST+FSPSRSTF
Sbjct  380  YDSFGRLLRRAIDPDPRRRFASAEEMSGQLMGVLREVVAQDTGVPRPGLSTVFSPSRSTF  439

Query  423  GVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDS  482
            GVDLLVAHTDVY DGQVH+EKLTA EIVTAL VPLVD TDVAASVLQATVLSQPVQTLDS
Sbjct  440  GVDLLVAHTDVYQDGQVHSEKLTAKEIVTALQVPLVDRTDVAASVLQATVLSQPVQTLDS  499

Query  483  LRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYR  542
            LRAARHGALD+DG D SESVELPLMEVRALLDLGDVAKATRKLDDL+ERVGWRWRLVWYR
Sbjct  500  LRAARHGALDSDGADLSESVELPLMEVRALLDLGDVAKATRKLDDLSERVGWRWRLVWYR  559

Query  543  AVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGV  602
            AV+ELLTG YD+A KHFTEVLDTFPGELAPKLALAATAELAG TD   FYQTVWSTNDGV
Sbjct  560  AVSELLTGAYDAAIKHFTEVLDTFPGELAPKLALAATAELAGYTDGTNFYQTVWSTNDGV  619

Query  603  ISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIR  662
            ISAAFGLAR  SA+G+R GAVRTLDEVPP+SRHFTTARLTSAVTLLSGRS  E+TEEQIR
Sbjct  620  ISAAFGLARTLSAQGERAGAVRTLDEVPPSSRHFTTARLTSAVTLLSGRSHGEITEEQIR  679

Query  663  DAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLR  722
            DAARRVEALPPTEPRVLQIRALVLGGA+DWL+DN+ASTNHILGFPFT HGLRLGVEASLR
Sbjct  680  DAARRVEALPPTEPRVLQIRALVLGGAMDWLQDNEASTNHILGFPFTDHGLRLGVEASLR  739

Query  723  SLARVAPTQRHRYTLVDMANKVRPTSTF  750
            SLARVAPTQRHRYTLVDMANKVRPTSTF
Sbjct  740  SLARVAPTQRHRYTLVDMANKVRPTSTF  767


>gi|118618244|ref|YP_906576.1| serine/threonine-protein kinase PknG [Mycobacterium ulcerans 
Agy99]
 gi|118570354|gb|ABL05105.1| serine/threonine-protein kinase PknG [Mycobacterium ulcerans 
Agy99]
Length=732

 Score = 1285 bits (3325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/732 (88%), Positives = 684/732 (94%), Gaps = 2/732 (0%)

Query  20   QTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGP-DTEPQDRMATTSRVRPPVRRLGGGL  78
            QT  +A  RP+ TQA+FRP+F D+D     TLG  D +PQ  +A  +R R PVRRLGGGL
Sbjct  2    QTGAAAWSRPIGTQALFRPNFDDDDED-DITLGTLDMQPQGPLAAATRARLPVRRLGGGL  60

Query  79   VEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFL  138
            VEIPR PD DPL+ALMT+PVVPE+KRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFL
Sbjct  61   VEIPRVPDTDPLKALMTDPVVPEAKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFL  120

Query  139  PQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAE  198
            PQL+PGD +AGQYEVKGCIAHGG+GWIYLALDRNVN RPVVLKGLVHSGDAEAQA+AMAE
Sbjct  121  PQLSPGDTIAGQYEVKGCIAHGGMGWIYLALDRNVNDRPVVLKGLVHSGDAEAQAIAMAE  180

Query  199  RQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKLPVAEAIAYLL  258
            RQFLAEVVHPSIVQIFNFVEHTD+HGDPVGYIVMEYVGG+SLKR KG+KLPV+EAIAYLL
Sbjct  181  RQFLAEVVHPSIVQIFNFVEHTDKHGDPVGYIVMEYVGGRSLKRRKGEKLPVSEAIAYLL  240

Query  259  EILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIV  318
            EILPAL+YLH++GLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLY TPGFQAPEIV
Sbjct  241  EILPALAYLHALGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYVTPGFQAPEIV  300

Query  319  RTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDP  378
            RTGPTVATDIYTVGRTLAALTL+LPTRNGRY+DGLP+DDPVL +YDS+GRLLRRAIDPDP
Sbjct  301  RTGPTVATDIYTVGRTLAALTLNLPTRNGRYLDGLPDDDPVLASYDSFGRLLRRAIDPDP  360

Query  379  RQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQ  438
            R+RF +AEEMS QL GVLREVVAQDTGVPRPGLST+FSPSRSTFGVDLLVAHTDVY DGQ
Sbjct  361  RRRFASAEEMSGQLMGVLREVVAQDTGVPRPGLSTVFSPSRSTFGVDLLVAHTDVYQDGQ  420

Query  439  VHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDF  498
            VH+EKLTA EIVTAL VPLVD TDVAASVLQATVLSQPVQTLDSLRAARHGALD+DG D 
Sbjct  421  VHSEKLTAKEIVTALQVPLVDRTDVAASVLQATVLSQPVQTLDSLRAARHGALDSDGADL  480

Query  499  SESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKH  558
            SESVELPLMEVRALLDLGDVAKATRKLDDL+ERVGWRWRLVWYRAV+ELLTG YD+A KH
Sbjct  481  SESVELPLMEVRALLDLGDVAKATRKLDDLSERVGWRWRLVWYRAVSELLTGAYDAAIKH  540

Query  559  FTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGD  618
            FTEVLDTFPGELAPKLALAATAELAG TD   FYQTVWSTNDGVISAAFGLAR  SA+G+
Sbjct  541  FTEVLDTFPGELAPKLALAATAELAGYTDGTNFYQTVWSTNDGVISAAFGLARTLSAQGE  600

Query  619  RVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRV  678
            R GAVRTLDEVPP+SRHFTTARLTSAVTLLSGRS  E+TEEQIRDAARRVEALPPTEPRV
Sbjct  601  RAGAVRTLDEVPPSSRHFTTARLTSAVTLLSGRSHGEITEEQIRDAARRVEALPPTEPRV  660

Query  679  LQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLV  738
            LQIRALVLGGA+DWL+DN+ASTNHILGFPFT HGLRLGVEASLRSLARVAPTQRHRYTLV
Sbjct  661  LQIRALVLGGAMDWLQDNEASTNHILGFPFTDHGLRLGVEASLRSLARVAPTQRHRYTLV  720

Query  739  DMANKVRPTSTF  750
            DMANKVRPTSTF
Sbjct  721  DMANKVRPTSTF  732


>gi|342859110|ref|ZP_08715764.1| serine/threonine protein kinase [Mycobacterium colombiense CECT 
3035]
 gi|342133351|gb|EGT86554.1| serine/threonine protein kinase [Mycobacterium colombiense CECT 
3035]
Length=764

 Score = 1270 bits (3287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/743 (87%), Positives = 679/743 (92%), Gaps = 3/743 (0%)

Query  11   GPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNF--PHPTLGP-DTEPQDRMATTSRV  67
            GPGTQPAD QT   AT R  +TQA+FRPDF D+D+   PH +LG  DT+ QDRM   +R 
Sbjct  22   GPGTQPADVQTGGPATGRLQATQALFRPDFDDDDDDDFPHISLGATDTDLQDRMTVATRS  81

Query  68   RPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGW  127
             P VR+LGGGLVEIPR  DIDP EALMTNPVVPESKRFCWNCG+PVGRS  + KG SEGW
Sbjct  82   VPAVRQLGGGLVEIPRGRDIDPREALMTNPVVPESKRFCWNCGKPVGRSSKKAKGTSEGW  141

Query  128  CPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSG  187
            CP CGSPYSFLPQLNPGDIVA QYEVKGCIAHGGLGW+YLA+D NVN RPVVLKGLVHSG
Sbjct  142  CPSCGSPYSFLPQLNPGDIVANQYEVKGCIAHGGLGWVYLAVDHNVNDRPVVLKGLVHSG  201

Query  188  DAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQK  247
            DAEAQA+AMAERQFLAEVVHP IVQIFNFVEHTD+HG+PVG IVMEYVGGQ L+  KG+K
Sbjct  202  DAEAQAIAMAERQFLAEVVHPQIVQIFNFVEHTDQHGNPVGLIVMEYVGGQPLRHGKGEK  261

Query  248  LPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLY  307
            LPVAEA+AY+LEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLY
Sbjct  262  LPVAEAVAYVLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLY  321

Query  308  GTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYG  367
            GTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL+L TRNGRYVDGLPE DPVL TYDS+ 
Sbjct  322  GTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLNLQTRNGRYVDGLPEHDPVLTTYDSFR  381

Query  368  RLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLL  427
            RLLRRAIDPDPR+RF + EEMSAQL GVLREVVA DTGVPRPGLSTIFSPSRSTFGVDLL
Sbjct  382  RLLRRAIDPDPRRRFLSTEEMSAQLMGVLREVVAADTGVPRPGLSTIFSPSRSTFGVDLL  441

Query  428  VAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAAR  487
            VAHTDVYLDGQVH+EKLTA EIVTAL VPLVDP DVAA VLQATVLSQPVQTLDSLRAAR
Sbjct  442  VAHTDVYLDGQVHSEKLTAREIVTALQVPLVDPADVAAPVLQATVLSQPVQTLDSLRAAR  501

Query  488  HGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAEL  547
            HG LDADG++ SESVELPLMEVRALLDLGDVAKATRKLDDLAERVGW+WRLVWY+AVAEL
Sbjct  502  HGTLDADGIEVSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWQWRLVWYKAVAEL  561

Query  548  LTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAF  607
            LTGDYDSAT HFTEVLDTFPGELAPKLALAATAELAG+ D+HKFY+TVW TNDGVISAAF
Sbjct  562  LTGDYDSATTHFTEVLDTFPGELAPKLALAATAELAGDVDDHKFYETVWKTNDGVISAAF  621

Query  608  GLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARR  667
            GLAR  SAEGDR  AVRTLDEVP TSRHFTTARLTSAVTLLSGR+ SE+TEE IRDAARR
Sbjct  622  GLARTLSAEGDRAAAVRTLDEVPATSRHFTTARLTSAVTLLSGRTKSEITEEDIRDAARR  681

Query  668  VEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARV  727
            VEALPPTEPRVLQIRALVLG A+DWL+DNKASTNHILGFPFT HGLRLGVEASLR+LARV
Sbjct  682  VEALPPTEPRVLQIRALVLGCAMDWLEDNKASTNHILGFPFTEHGLRLGVEASLRNLARV  741

Query  728  APTQRHRYTLVDMANKVRPTSTF  750
            APTQRHRY LVDMAN+VRPTSTF
Sbjct  742  APTQRHRYALVDMANRVRPTSTF  764


>gi|336460366|gb|EGO39266.1| serine/threonine protein kinase [Mycobacterium avium subsp. paratuberculosis 
S397]
Length=763

 Score = 1270 bits (3286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/749 (86%), Positives = 686/749 (92%), Gaps = 7/749 (0%)

Query  8    ERSGPGTQPA----DAQTATSATVRPLSTQAVFRPDFGDEDNF-PHPTLGP-DTEPQDRM  61
            E+ GPGTQPA    DAQ A +AT R  +TQA+FRPDF D+D+  PH +LG  DT+  DRM
Sbjct  16   EQMGPGTQPAEVGDDAQ-AGAATGRLQATQALFRPDFDDDDDDFPHISLGALDTDSADRM  74

Query  62   ATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETK  121
               +R  PPVR+LGGGLVEIPR  DIDP EALMTNPVVPESKRFCWNCG+PVGRS  ++K
Sbjct  75   TVATRALPPVRQLGGGLVEIPRGRDIDPREALMTNPVVPESKRFCWNCGKPVGRSTKKSK  134

Query  122  GASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLK  181
            G SEGWCP+CGS YSFLPQLNPGDIVA QYEVKGCIAHGGLGW+YLA+D NVN RPVVLK
Sbjct  135  GTSEGWCPHCGSAYSFLPQLNPGDIVANQYEVKGCIAHGGLGWVYLAVDHNVNDRPVVLK  194

Query  182  GLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLK  241
            GLVHSGDAEAQA+AMAERQFLAEVVHP IVQIFNFVEH DRHG+PVGYIVMEYVGGQ L+
Sbjct  195  GLVHSGDAEAQAIAMAERQFLAEVVHPQIVQIFNFVEHVDRHGNPVGYIVMEYVGGQPLR  254

Query  242  RSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRIN  301
              KG+KLPV+EAIAY+LEILPAL YLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRIN
Sbjct  255  HGKGEKLPVSEAIAYVLEILPALGYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRIN  314

Query  302  SFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLK  361
            SFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL+LPTRNGRYVDG+P++DPVL 
Sbjct  315  SFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLNLPTRNGRYVDGIPDNDPVLG  374

Query  362  TYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRST  421
            TYDS+ RLLRRA DPDPR+RF++ EEMSAQL GVLREVVA DTGVPRPGLSTIFSPSRST
Sbjct  375  TYDSFRRLLRRATDPDPRRRFSSTEEMSAQLMGVLREVVAHDTGVPRPGLSTIFSPSRST  434

Query  422  FGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLD  481
            FGVDLLVAHTDVYLDGQVH+EKLTA EIVTAL VPLVDP DVAA VLQATVLSQPVQTLD
Sbjct  435  FGVDLLVAHTDVYLDGQVHSEKLTAREIVTALQVPLVDPADVAAPVLQATVLSQPVQTLD  494

Query  482  SLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWY  541
            SLRAARHG LDADGV+ SES+ELPLMEVRALLDLGDVAKATRKLDDLAERVGW+WRLVWY
Sbjct  495  SLRAARHGTLDADGVELSESIELPLMEVRALLDLGDVAKATRKLDDLAERVGWQWRLVWY  554

Query  542  RAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDG  601
            +AVAELLTGDYDSAT HFTEVLDTFPGELAPKLALAATAELAG+ DEH+FY+TVW TNDG
Sbjct  555  KAVAELLTGDYDSATTHFTEVLDTFPGELAPKLALAATAELAGDVDEHRFYETVWKTNDG  614

Query  602  VISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQI  661
            VISAAFGLAR  SAEGDR  AVRTLDEVP TSRHFTTARLTSAVTLLSGRS SE+TEE+I
Sbjct  615  VISAAFGLARTLSAEGDRAAAVRTLDEVPATSRHFTTARLTSAVTLLSGRSKSEITEEEI  674

Query  662  RDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASL  721
            RDAARRVEALPPTEPRVLQIRALVLG A+DWL+DNKASTNHILGFPFT HGLRLGVEA+L
Sbjct  675  RDAARRVEALPPTEPRVLQIRALVLGCAMDWLEDNKASTNHILGFPFTEHGLRLGVEAAL  734

Query  722  RSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            R+LARVAPTQRHRY LVDMANKVRPTSTF
Sbjct  735  RNLARVAPTQRHRYALVDMANKVRPTSTF  763


>gi|41409991|ref|NP_962827.1| PknG [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|41398824|gb|AAS06443.1| PknG [Mycobacterium avium subsp. paratuberculosis K-10]
Length=763

 Score = 1269 bits (3283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/749 (86%), Positives = 686/749 (92%), Gaps = 7/749 (0%)

Query  8    ERSGPGTQPA----DAQTATSATVRPLSTQAVFRPDFGDEDNF-PHPTLGP-DTEPQDRM  61
            E+ GPGTQPA    DAQ A +AT R  +TQA+FRPDF D+D+  PH +LG  DT+  DRM
Sbjct  16   EQMGPGTQPAEVGDDAQ-AGAATGRLQATQALFRPDFDDDDDDFPHISLGALDTDSADRM  74

Query  62   ATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETK  121
               ++  PPVR+LGGGLVEIPR  DIDP EALMTNPVVPESKRFCWNCG+PVGRS  ++K
Sbjct  75   TVATQALPPVRQLGGGLVEIPRGRDIDPREALMTNPVVPESKRFCWNCGKPVGRSTKKSK  134

Query  122  GASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLK  181
            G SEGWCP+CGS YSFLPQLNPGDIVA QYEVKGCIAHGGLGW+YLA+D NVN RPVVLK
Sbjct  135  GTSEGWCPHCGSAYSFLPQLNPGDIVANQYEVKGCIAHGGLGWVYLAVDHNVNDRPVVLK  194

Query  182  GLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLK  241
            GLVHSGDAEAQA+AMAERQFLAEVVHP IVQIFNFVEH DRHG+PVGYIVMEYVGGQ L+
Sbjct  195  GLVHSGDAEAQAIAMAERQFLAEVVHPQIVQIFNFVEHVDRHGNPVGYIVMEYVGGQPLR  254

Query  242  RSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRIN  301
              KG+KLPV+EAIAY+LEILPAL YLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRIN
Sbjct  255  HGKGEKLPVSEAIAYVLEILPALGYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRIN  314

Query  302  SFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLK  361
            SFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL+LPTRNGRYVDG+P++DPVL 
Sbjct  315  SFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLNLPTRNGRYVDGIPDNDPVLG  374

Query  362  TYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRST  421
            TYDS+ RLLRRA DPDPR+RF++ EEMSAQL GVLREVVA DTGVPRPGLSTIFSPSRST
Sbjct  375  TYDSFRRLLRRATDPDPRRRFSSTEEMSAQLMGVLREVVAHDTGVPRPGLSTIFSPSRST  434

Query  422  FGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLD  481
            FGVDLLVAHTDVYLDGQVH+EKLTA EIVTAL VPLVDP DVAA VLQATVLSQPVQTLD
Sbjct  435  FGVDLLVAHTDVYLDGQVHSEKLTAREIVTALQVPLVDPADVAAPVLQATVLSQPVQTLD  494

Query  482  SLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWY  541
            SLRAARHG LDADGV+ SES+ELPLMEVRALLDLGDVAKATRKLDDLAERVGW+WRLVWY
Sbjct  495  SLRAARHGTLDADGVELSESIELPLMEVRALLDLGDVAKATRKLDDLAERVGWQWRLVWY  554

Query  542  RAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDG  601
            +AVAELLTGDYDSAT HFTEVLDTFPGELAPKLALAATAELAG+ DEH+FY+TVW TNDG
Sbjct  555  KAVAELLTGDYDSATTHFTEVLDTFPGELAPKLALAATAELAGDVDEHRFYETVWKTNDG  614

Query  602  VISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQI  661
            VISAAFGLAR  SAEGDR  AVRTLDEVP TSRHFTTARLTSAVTLLSGRS SE+TEE+I
Sbjct  615  VISAAFGLARTLSAEGDRAAAVRTLDEVPATSRHFTTARLTSAVTLLSGRSKSEITEEEI  674

Query  662  RDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASL  721
            RDAARRVEALPPTEPRVLQIRALVLG A+DWL+DNKASTNHILGFPFT HGLRLGVEA+L
Sbjct  675  RDAARRVEALPPTEPRVLQIRALVLGCAMDWLEDNKASTNHILGFPFTEHGLRLGVEAAL  734

Query  722  RSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            R+LARVAPTQRHRY LVDMANKVRPTSTF
Sbjct  735  RNLARVAPTQRHRYALVDMANKVRPTSTF  763


>gi|254777190|ref|ZP_05218706.1| serine/threonine protein kinase PknG [Mycobacterium avium subsp. 
avium ATCC 25291]
Length=763

 Score = 1268 bits (3282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/750 (86%), Positives = 686/750 (92%), Gaps = 7/750 (0%)

Query  7    TERSGPGTQPA----DAQTATSATVRPLSTQAVFRPDFGDEDNF-PHPTLGP-DTEPQDR  60
            TE+ GPGTQPA    DAQ   +AT R  +TQA+FRPDF D+D+  PH +LG  DT+  DR
Sbjct  15   TEQVGPGTQPAEVGDDAQGG-AATGRLQATQALFRPDFDDDDDDFPHISLGALDTDSADR  73

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            M   +R  PPVR+LGGGLVEIPR  DIDP EALMTNPVVPESKRFCWNCG+PVGRS  ++
Sbjct  74   MTVATRALPPVRQLGGGLVEIPRGRDIDPREALMTNPVVPESKRFCWNCGKPVGRSTKKS  133

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KG SEGWCP+CGS YSFLPQLNPGDIVA QYEVKGCIAHGGLGW+YLA+D NVN RPVVL
Sbjct  134  KGTSEGWCPHCGSAYSFLPQLNPGDIVANQYEVKGCIAHGGLGWVYLAVDHNVNDRPVVL  193

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQA+AMAERQFLAEVVHP IVQIFNFVEH DRHG+PVGYIVMEYVGGQ L
Sbjct  194  KGLVHSGDAEAQAIAMAERQFLAEVVHPQIVQIFNFVEHVDRHGNPVGYIVMEYVGGQPL  253

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            +  KG+KLPV+EAIAY+LEILPAL YLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  254  RHGKGEKLPVSEAIAYVLEILPALGYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  313

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL+LPTRNGRYVDG+P++DPVL
Sbjct  314  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLNLPTRNGRYVDGIPDNDPVL  373

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
             TYDS+ RLLRRA DPDPR+RF++ EEMSAQL GVLREVVA DTGVPRPGLSTIFSPSRS
Sbjct  374  GTYDSFRRLLRRATDPDPRRRFSSTEEMSAQLMGVLREVVAHDTGVPRPGLSTIFSPSRS  433

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVH+EKLTA EIVTAL VPLVDP DVAA VLQATVLSQPVQTL
Sbjct  434  TFGVDLLVAHTDVYLDGQVHSEKLTAREIVTALQVPLVDPADVAAPVLQATVLSQPVQTL  493

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHG LDADGV+ SES+ELPLMEVRALLDLGDVAKATRKLDDLAERVGW+WRLVW
Sbjct  494  DSLRAARHGTLDADGVELSESIELPLMEVRALLDLGDVAKATRKLDDLAERVGWQWRLVW  553

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            Y+AVAELLTGDYDSAT HFTEVLDTFPGELAPKLALAATAELAG+ DEH+FY+TVW TND
Sbjct  554  YKAVAELLTGDYDSATTHFTEVLDTFPGELAPKLALAATAELAGDVDEHRFYETVWKTND  613

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLAR  SAEGDR  AVRTLDEVP TSRHFTTARLTSAVTLLSGRS SE+TEE+
Sbjct  614  GVISAAFGLARTLSAEGDRAAAVRTLDEVPATSRHFTTARLTSAVTLLSGRSKSEITEEE  673

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLG A+DWL+DNKASTNHILGFPFT HGLRLGVEA+
Sbjct  674  IRDAARRVEALPPTEPRVLQIRALVLGCAMDWLEDNKASTNHILGFPFTEHGLRLGVEAA  733

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LR+LARVAPTQRHRY LVDMANKVRPTSTF
Sbjct  734  LRNLARVAPTQRHRYALVDMANKVRPTSTF  763


>gi|254818983|ref|ZP_05223984.1| PknG [Mycobacterium intracellulare ATCC 13950]
Length=762

 Score = 1268 bits (3280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/745 (87%), Positives = 679/745 (92%), Gaps = 3/745 (0%)

Query  8    ERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNF-PHPTLGP-DTEPQDRMATTS  65
            E   PGTQPA+ QT  S T R  +TQA+FRPDF D+D+  PH  LG  DT+  DRM   +
Sbjct  19   EDVNPGTQPAEVQTGAS-TGRLQATQALFRPDFDDDDDDFPHIALGALDTDTGDRMTVAT  77

Query  66   RVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASE  125
            R  P VR+LGGGLVEIPR  DIDP EALMTNPVVPESKRFCWNCG+PVGRS  ++KG SE
Sbjct  78   RALPAVRQLGGGLVEIPRGRDIDPREALMTNPVVPESKRFCWNCGKPVGRSSKKSKGTSE  137

Query  126  GWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVH  185
            GWCP CGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGW+YLA+D+NVN RPVVLKGLVH
Sbjct  138  GWCPACGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWVYLAVDKNVNDRPVVLKGLVH  197

Query  186  SGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKG  245
            SGDAEAQA+AMAERQFLAEVVHP IVQIFNFVEH D+HG+PVGYIVMEYVGGQSLK  KG
Sbjct  198  SGDAEAQAIAMAERQFLAEVVHPQIVQIFNFVEHKDQHGNPVGYIVMEYVGGQSLKHGKG  257

Query  246  QKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGY  305
            +KLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGY
Sbjct  258  EKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGY  317

Query  306  LYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDS  365
            LYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL+L TRNGRYVDGLPE DPVL TYDS
Sbjct  318  LYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLNLRTRNGRYVDGLPEHDPVLATYDS  377

Query  366  YGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVD  425
            + RLLRRA DPDPR+RF + EEMSAQL GVLREVVA DTGVPRPGLSTIFSPSRSTFGVD
Sbjct  378  FHRLLRRATDPDPRRRFASTEEMSAQLIGVLREVVAHDTGVPRPGLSTIFSPSRSTFGVD  437

Query  426  LLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRA  485
            LLVAHTDVYLDGQVH+EKLTA EIVTAL VPLV+P DVAASVLQATVLSQPVQTLDSLRA
Sbjct  438  LLVAHTDVYLDGQVHSEKLTAREIVTALQVPLVNPADVAASVLQATVLSQPVQTLDSLRA  497

Query  486  ARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVA  545
            ARHG LDADG + SESVELPLMEVRALLDLGDVAKATRKL+DLAERVGW+WRLVWY+AVA
Sbjct  498  ARHGTLDADGAELSESVELPLMEVRALLDLGDVAKATRKLEDLAERVGWQWRLVWYKAVA  557

Query  546  ELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISA  605
            +LLTGDYDSAT HFTEVLDTFPGELAPKLALAATAELAG+ DEHK Y+TVW TNDGVISA
Sbjct  558  DLLTGDYDSATTHFTEVLDTFPGELAPKLALAATAELAGDVDEHKHYETVWKTNDGVISA  617

Query  606  AFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAA  665
            AFGLAR  SAEGDR  AVRTLDEVP TSRHFTTARLTSAVTLLSGRS SE+TEE IRDAA
Sbjct  618  AFGLARTLSAEGDRAAAVRTLDEVPATSRHFTTARLTSAVTLLSGRSKSEITEEDIRDAA  677

Query  666  RRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLA  725
            RRVEALPPTEPRVLQIRALVLG A+DWL+DNKASTNHILGFPFT HGLRLGVEA+LR+LA
Sbjct  678  RRVEALPPTEPRVLQIRALVLGCAMDWLEDNKASTNHILGFPFTEHGLRLGVEAALRNLA  737

Query  726  RVAPTQRHRYTLVDMANKVRPTSTF  750
            RVAPTQRHRY LVDMAN+VRPTSTF
Sbjct  738  RVAPTQRHRYELVDMANRVRPTSTF  762


>gi|118463342|ref|YP_883878.1| serine/threonine protein kinase [Mycobacterium avium 104]
 gi|118164629|gb|ABK65526.1| serine/threonine protein kinase PknG [Mycobacterium avium 104]
Length=763

 Score = 1265 bits (3274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/750 (86%), Positives = 685/750 (92%), Gaps = 7/750 (0%)

Query  7    TERSGPGTQPA----DAQTATSATVRPLSTQAVFRPDFGDEDNF-PHPTLGP-DTEPQDR  60
            TE+ GPGTQPA    DAQ   +AT R  +TQA+FRPDF D+D+  PH +LG  DT+  DR
Sbjct  15   TEQVGPGTQPAEVGDDAQGG-AATGRLQATQALFRPDFDDDDDDFPHISLGALDTDSADR  73

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            M   +R  PPVR+LGGGLVEIPR  DIDP EALMTNPVVPESKRFCWNCG+PVGRS  ++
Sbjct  74   MTVATRALPPVRQLGGGLVEIPRGRDIDPREALMTNPVVPESKRFCWNCGKPVGRSTKKS  133

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KG SEGWCP+CGS YSFLPQLNPGDIVA QYEVKGCIAHGGLGW+YLA+D NVN RPVVL
Sbjct  134  KGTSEGWCPHCGSAYSFLPQLNPGDIVANQYEVKGCIAHGGLGWVYLAVDHNVNDRPVVL  193

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQA+AMAERQFLAEVVHP IVQIFNFVEH DRHG+PVGYIVMEYVGGQ L
Sbjct  194  KGLVHSGDAEAQAIAMAERQFLAEVVHPQIVQIFNFVEHVDRHGNPVGYIVMEYVGGQPL  253

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            +  KG+KLPV+EAIAY+LEILPAL YLHSIGLVYNDLKPENIMLTEEQL+LIDLGAVSRI
Sbjct  254  RHGKGEKLPVSEAIAYVLEILPALGYLHSIGLVYNDLKPENIMLTEEQLELIDLGAVSRI  313

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTL+LPTRNGRYVDG+P++DPVL
Sbjct  314  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLNLPTRNGRYVDGIPDNDPVL  373

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
              YDS+ RLLRRA DPDPR+RF++ EEMSAQL GVLREVVA DTGVPRPGLSTIFSPSRS
Sbjct  374  GAYDSFRRLLRRATDPDPRRRFSSTEEMSAQLMGVLREVVAHDTGVPRPGLSTIFSPSRS  433

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVH+EKLTA EIVTAL VPLVDP DVAA VLQATVLSQPVQTL
Sbjct  434  TFGVDLLVAHTDVYLDGQVHSEKLTAREIVTALQVPLVDPADVAAPVLQATVLSQPVQTL  493

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHG LDADGV+ SES+ELPLMEVRALLDLGDVAKATRKLDDLAERVGW+WRLVW
Sbjct  494  DSLRAARHGTLDADGVELSESIELPLMEVRALLDLGDVAKATRKLDDLAERVGWQWRLVW  553

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            Y+AVAELLTGDYDSAT HFTEVLDTFPGELAPKLALAATAELAG+ DEH+FY+TVW TND
Sbjct  554  YKAVAELLTGDYDSATTHFTEVLDTFPGELAPKLALAATAELAGDVDEHRFYETVWKTND  613

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISAAFGLAR  SAEGDR  AVRTLDEVP TSRHFTTARLTSAVTLLSGRS SE+TEE+
Sbjct  614  GVISAAFGLARTLSAEGDRAAAVRTLDEVPATSRHFTTARLTSAVTLLSGRSKSEITEEE  673

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IRDAARRVEALPPTEPRVLQIRALVLG A+DWL+DNKASTNHILGFPFT HGLRLGVEA+
Sbjct  674  IRDAARRVEALPPTEPRVLQIRALVLGCAMDWLEDNKASTNHILGFPFTEHGLRLGVEAA  733

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LR+LARVAPTQRHRY LVDMANKVRPTSTF
Sbjct  734  LRNLARVAPTQRHRYALVDMANKVRPTSTF  763


>gi|296167868|ref|ZP_06850051.1| non-specific serine/threonine protein kinase [Mycobacterium parascrofulaceum 
ATCC BAA-614]
 gi|295896993|gb|EFG76616.1| non-specific serine/threonine protein kinase [Mycobacterium parascrofulaceum 
ATCC BAA-614]
Length=759

 Score = 1262 bits (3265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/754 (86%), Positives = 681/754 (91%), Gaps = 6/754 (0%)

Query  3    KASETERSG----PGTQPADAQTATSATVRPLSTQAVFRPDFGDEDN-FPHPTLGP-DTE  56
            KA  TE       PGTQP D Q     T R  +TQA+FRPDF DED+  PH +LG  D+E
Sbjct  6    KAEHTEPGADDVSPGTQPPDTQGGGPTTGRIQATQALFRPDFDDEDDDLPHISLGTVDSE  65

Query  57   PQDRMATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRS  116
            PQDR+   +RV PPVR+LGGGLVEIPR  DIDPLEALMTNPVVPE+KRFCWNCG+PVGRS
Sbjct  66   PQDRVTIGTRVLPPVRQLGGGLVEIPRVRDIDPLEALMTNPVVPEAKRFCWNCGKPVGRS  125

Query  117  DSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGR  176
                KG SEGWCP CGS YSFLPQLNPG+IVAGQYEVKGCIAHGGLGW+YLA+D NVN R
Sbjct  126  SKGVKGESEGWCPACGSAYSFLPQLNPGEIVAGQYEVKGCIAHGGLGWVYLAVDHNVNDR  185

Query  177  PVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVG  236
            PVVLKGLVHSGDAEAQA+AMAERQFLAEVVHP IVQIFNFVEH DR G+PVGYIVMEY+G
Sbjct  186  PVVLKGLVHSGDAEAQAIAMAERQFLAEVVHPQIVQIFNFVEHKDRGGNPVGYIVMEYIG  245

Query  237  GQSLKRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGA  296
            GQ LK  K +KLPVAEAIAYLLEILPAL+YLHSIGLVYNDLKPENIMLTEEQLKLIDLGA
Sbjct  246  GQPLKHGKDKKLPVAEAIAYLLEILPALTYLHSIGLVYNDLKPENIMLTEEQLKLIDLGA  305

Query  297  VSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPED  356
            VSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALT++LPTRNGRYVDGLPE 
Sbjct  306  VSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTVNLPTRNGRYVDGLPEH  365

Query  357  DPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFS  416
            DP L TYDS+ RLLRRA DPDPR+RF + EEMSAQL GVLREVVAQDTG+PRPGLSTIFS
Sbjct  366  DPALTTYDSFRRLLRRATDPDPRRRFASTEEMSAQLMGVLREVVAQDTGIPRPGLSTIFS  425

Query  417  PSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQP  476
            PSRSTFGVDLLVAHTDVYLDGQVH+E+LTA EIVTAL VPLVDPTDVAA VLQATVLSQP
Sbjct  426  PSRSTFGVDLLVAHTDVYLDGQVHSERLTAREIVTALQVPLVDPTDVAAPVLQATVLSQP  485

Query  477  VQTLDSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRW  536
            VQTLDSLRAARHG LDA+GV+ SES+ELPLMEVRALLDLGDVAKATRKLDDLAERVGW+W
Sbjct  486  VQTLDSLRAARHGTLDAEGVEVSESIELPLMEVRALLDLGDVAKATRKLDDLAERVGWQW  545

Query  537  RLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVW  596
            RLVWYRAV+ELLTGDYDSAT HFTEVLDTFPGELAPKLALAATAELAG+ DE K+YQTVW
Sbjct  546  RLVWYRAVSELLTGDYDSATTHFTEVLDTFPGELAPKLALAATAELAGDVDEQKYYQTVW  605

Query  597  STNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEV  656
             TNDGVISAAFGLAR  SAEGDR  AVRTLDEVPPTSRHFTTARLTSAVTLLSGR+ SE+
Sbjct  606  KTNDGVISAAFGLARWLSAEGDRAAAVRTLDEVPPTSRHFTTARLTSAVTLLSGRTKSEI  665

Query  657  TEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLG  716
            TEE IRDAARRVEALPPTEPRVLQIRALVLG A+DWL+DNKASTNHILGFPFT HGLRLG
Sbjct  666  TEEDIRDAARRVEALPPTEPRVLQIRALVLGCAMDWLEDNKASTNHILGFPFTEHGLRLG  725

Query  717  VEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            VEA+LR+LARVAPTQRHRY LVDMAN+VRPTSTF
Sbjct  726  VEAALRNLARVAPTQRHRYELVDMANRVRPTSTF  759


>gi|15827075|ref|NP_301338.1| serine-threonine protein kinase [Mycobacterium leprae TN]
 gi|221229553|ref|YP_002502969.1| putative serine-threonine protein kinase [Mycobacterium leprae 
Br4923]
 gi|13092623|emb|CAC29812.1| putative serine-threonine protein kinase [Mycobacterium leprae]
 gi|219932660|emb|CAR70397.1| putative serine-threonine protein kinase [Mycobacterium leprae 
Br4923]
Length=767

 Score = 1242 bits (3213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/756 (84%), Positives = 677/756 (90%), Gaps = 12/756 (1%)

Query  6    ETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTL-GPDTEPQDRMATT  64
            +TE  G   Q AD  + T+   R  STQA+FRP+F D+D+  H ++   DTEPQDR+   
Sbjct  13   DTEDVGQAAQRADPPSGTTEG-RLQSTQAIFRPNFDDDDDLLHISVPSVDTEPQDRITPA  71

Query  65   SRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSE-----  119
            +RV PP+R+LGGGLVEI R  DIDPLEALMTNPVVPESKRFCWNCGRPVGRS+ E     
Sbjct  72   TRVLPPIRQLGGGLVEIRRVRDIDPLEALMTNPVVPESKRFCWNCGRPVGRSELEGQEAD  131

Query  120  -TKGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPV  178
              +GA EGWCPYCGSPYSFLPQL+PGDIVAGQYEVKGCIAHGGLGW+YLA D NVN RPV
Sbjct  132  GAQGAKEGWCPYCGSPYSFLPQLSPGDIVAGQYEVKGCIAHGGLGWVYLAFDHNVNDRPV  191

Query  179  VLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQ  238
            VLKGLVHSGDAEAQA A+AERQFLAEVVHP IVQIFNFVEH D  GDPVGYIVMEY+GG+
Sbjct  192  VLKGLVHSGDAEAQASAVAERQFLAEVVHPQIVQIFNFVEHKDTSGDPVGYIVMEYIGGR  251

Query  239  SLKR--SKG--QKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDL  294
            SLKR   KG  +KLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDL
Sbjct  252  SLKRGSKKGNVEKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDL  311

Query  295  GAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLP  354
            GAVSRINSFG +YGTPG+QAPEIVRTGPTVATDIYTVGRTLAALTL+L TRNGRY+DGLP
Sbjct  312  GAVSRINSFGCIYGTPGYQAPEIVRTGPTVATDIYTVGRTLAALTLNLRTRNGRYMDGLP  371

Query  355  EDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTI  414
            EDDPVL TYDS+ RLL RAI+PDPR+RF++AEEMSAQL GVLREVVAQDTGVPR GLSTI
Sbjct  372  EDDPVLTTYDSFARLLHRAINPDPRRRFSSAEEMSAQLMGVLREVVAQDTGVPRAGLSTI  431

Query  415  FSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLS  474
            FSPSRSTFGVDLLVAHTDVYLDG++H+EKLTA +IVTAL VPLVDPTDVAA VLQATVLS
Sbjct  432  FSPSRSTFGVDLLVAHTDVYLDGRLHSEKLTAKDIVTALQVPLVDPTDVAAPVLQATVLS  491

Query  475  QPVQTLDSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGW  534
            QPVQTLDSLRAARHG LDA G+D +ESVELPLMEVRALLDLGDV KA RKLDDLA+RV  
Sbjct  492  QPVQTLDSLRAARHGMLDAQGIDLAESVELPLMEVRALLDLGDVVKANRKLDDLADRVSC  551

Query  535  RWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQT  594
            +WRLVWYRAVA+LLTGDY SATKHFTEVL+TFPGELAPKLALAATAELAG +DEHKFY+T
Sbjct  552  QWRLVWYRAVADLLTGDYASATKHFTEVLNTFPGELAPKLALAATAELAGESDEHKFYRT  611

Query  595  VWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTS  654
            VW TNDGV+SAAFGLAR +SAEGDR GAV TLDEVPPTSRHFTTARLTSAVTLLSGRST+
Sbjct  612  VWHTNDGVVSAAFGLARFQSAEGDRTGAVCTLDEVPPTSRHFTTARLTSAVTLLSGRSTN  671

Query  655  EVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLR  714
            E+TE+QIRDAARRVE LPPTEPRVLQIRALVLG A+DWL DN+AS NHILGFPFT HGLR
Sbjct  672  EITEQQIRDAARRVETLPPTEPRVLQIRALVLGCAMDWLADNQASANHILGFPFTKHGLR  731

Query  715  LGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LGVEASLRSLARVAPTQRHRYTLVDMANKVRPTST 
Sbjct  732  LGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTL  767


>gi|15214184|sp|P57993.2|PKNG_MYCLE RecName: Full=Probable serine/threonine-protein kinase pknG
 gi|4154050|emb|CAA22703.1| putative serine/threonine kinase [Mycobacterium leprae]
Length=763

 Score = 1240 bits (3208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/756 (84%), Positives = 677/756 (90%), Gaps = 12/756 (1%)

Query  6    ETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTL-GPDTEPQDRMATT  64
            +TE  G   Q AD  + T+   R  STQA+FRP+F D+D+  H ++   DTEPQDR+   
Sbjct  9    DTEDVGQAAQRADPPSGTTEG-RLQSTQAIFRPNFDDDDDLLHISVPSVDTEPQDRITPA  67

Query  65   SRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSE-----  119
            +RV PP+R+LGGGLVEI R  DIDPLEALMTNPVVPESKRFCWNCGRPVGRS+ E     
Sbjct  68   TRVLPPIRQLGGGLVEIRRVRDIDPLEALMTNPVVPESKRFCWNCGRPVGRSELEGQEAD  127

Query  120  -TKGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPV  178
              +GA EGWCPYCGSPYSFLPQL+PGDIVAGQYEVKGCIAHGGLGW+YLA D NVN RPV
Sbjct  128  GAQGAKEGWCPYCGSPYSFLPQLSPGDIVAGQYEVKGCIAHGGLGWVYLAFDHNVNDRPV  187

Query  179  VLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQ  238
            VLKGLVHSGDAEAQA A+AERQFLAEVVHP IVQIFNFVEH D  GDPVGYIVMEY+GG+
Sbjct  188  VLKGLVHSGDAEAQASAVAERQFLAEVVHPQIVQIFNFVEHKDTSGDPVGYIVMEYIGGR  247

Query  239  SLKR--SKG--QKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDL  294
            SLKR   KG  +KLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDL
Sbjct  248  SLKRGSKKGNVEKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDL  307

Query  295  GAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLP  354
            GAVSRINSFG +YGTPG+QAPEIVRTGPTVATDIYTVGRTLAALTL+L TRNGRY+DGLP
Sbjct  308  GAVSRINSFGCIYGTPGYQAPEIVRTGPTVATDIYTVGRTLAALTLNLRTRNGRYMDGLP  367

Query  355  EDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTI  414
            EDDPVL TYDS+ RLL RAI+PDPR+RF++AEEMSAQL GVLREVVAQDTGVPR GLSTI
Sbjct  368  EDDPVLTTYDSFARLLHRAINPDPRRRFSSAEEMSAQLMGVLREVVAQDTGVPRAGLSTI  427

Query  415  FSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLS  474
            FSPSRSTFGVDLLVAHTDVYLDG++H+EKLTA +IVTAL VPLVDPTDVAA VLQATVLS
Sbjct  428  FSPSRSTFGVDLLVAHTDVYLDGRLHSEKLTAKDIVTALQVPLVDPTDVAAPVLQATVLS  487

Query  475  QPVQTLDSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGW  534
            QPVQTLDSLRAARHG LDA G+D +ESVELPLMEVRALLDLGDV KA RKLDDLA+RV  
Sbjct  488  QPVQTLDSLRAARHGMLDAQGIDLAESVELPLMEVRALLDLGDVVKANRKLDDLADRVSC  547

Query  535  RWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQT  594
            +WRLVWYRAVA+LLTGDY SATKHFTEVL+TFPGELAPKLALAATAELAG +DEHKFY+T
Sbjct  548  QWRLVWYRAVADLLTGDYASATKHFTEVLNTFPGELAPKLALAATAELAGESDEHKFYRT  607

Query  595  VWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTS  654
            VW TNDGV+SAAFGLAR +SAEGDR GAV TLDEVPPTSRHFTTARLTSAVTLLSGRST+
Sbjct  608  VWHTNDGVVSAAFGLARFQSAEGDRTGAVCTLDEVPPTSRHFTTARLTSAVTLLSGRSTN  667

Query  655  EVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLR  714
            E+TE+QIRDAARRVE LPPTEPRVLQIRALVLG A+DWL DN+AS NHILGFPFT HGLR
Sbjct  668  EITEQQIRDAARRVETLPPTEPRVLQIRALVLGCAMDWLADNQASANHILGFPFTKHGLR  727

Query  715  LGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LGVEASLRSLARVAPTQRHRYTLVDMANKVRPTST 
Sbjct  728  LGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTL  763


>gi|120401718|ref|YP_951547.1| protein kinase [Mycobacterium vanbaalenii PYR-1]
 gi|119954536|gb|ABM11541.1| serine/threonine protein kinase [Mycobacterium vanbaalenii PYR-1]
Length=755

 Score = 1204 bits (3115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/746 (81%), Positives = 655/746 (88%), Gaps = 6/746 (0%)

Query  11   GPGTQPA---DAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDRMATTSRV  67
            G GTQPA   D    T +T+RP++TQAVFRP+F D++         DTEPQ    T +R 
Sbjct  10   GQGTQPAGYSDLADDTMSTMRPMATQAVFRPNFFDDEEDSDALHSGDTEPQLTTTTVTRH  69

Query  68   RPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGW  127
              P RRLGGGLVEIPR P  DPL ALMT+PVV ESKRFCWNCGRPVGRS  + +  SEGW
Sbjct  70   MSPTRRLGGGLVEIPRVPARDPLAALMTDPVVAESKRFCWNCGRPVGRSTKDGRALSEGW  129

Query  128  CPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSG  187
            CP+CGS YSFLPQLN GDIVA QYE+KGCIAHGGLGW+YLA D+NVN RPVVLKGLVHSG
Sbjct  130  CPHCGSAYSFLPQLNVGDIVADQYEIKGCIAHGGLGWVYLAFDKNVNDRPVVLKGLVHSG  189

Query  188  DAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRS---K  244
            DAEAQA+AMAERQFLA+V HP IV+I+NFVEH D+HG+PVGYIVMEYVGG SLK++   K
Sbjct  190  DAEAQAIAMAERQFLAQVTHPGIVKIYNFVEHEDKHGNPVGYIVMEYVGGTSLKQATAQK  249

Query  245  GQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFG  304
            G +LPVAEAI ++LEILPAL +LHSIGLVYNDLKPEN+M+TE+QLKLIDLGAVSRINSFG
Sbjct  250  GTRLPVAEAIGFMLEILPALGHLHSIGLVYNDLKPENVMVTEDQLKLIDLGAVSRINSFG  309

Query  305  YLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYD  364
            YLYGTPG+QAPEIVRTGPTVATD+YTVGRTLAALTL L TR GRYVDGLPEDDPVL TYD
Sbjct  310  YLYGTPGYQAPEIVRTGPTVATDMYTVGRTLAALTLKLRTRKGRYVDGLPEDDPVLATYD  369

Query  365  SYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGV  424
            SYGRLLRRAIDPDPR+RF +AEEMS+QL GVLREVVA+DTGVPRPGLST+FS SRSTFGV
Sbjct  370  SYGRLLRRAIDPDPRRRFQSAEEMSSQLMGVLREVVAKDTGVPRPGLSTVFSRSRSTFGV  429

Query  425  DLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLR  484
            DLLVAHTDVYLDGQVH+EKLTA EIV AL VPLVDPTDV A++L A VLSQPVQTLDSLR
Sbjct  430  DLLVAHTDVYLDGQVHSEKLTAQEIVRALQVPLVDPTDVGATILSAIVLSQPVQTLDSLR  489

Query  485  AARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAV  544
            AARHG LD++G+D SESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW+RAV
Sbjct  490  AARHGTLDSEGIDLSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWFRAV  549

Query  545  AELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVIS  604
            +ELLT DYDSATKHF EVLDT PGELAPKLALAATAELAG+ DE  FY TVWST++GVIS
Sbjct  550  SELLTADYDSATKHFNEVLDTLPGELAPKLALAATAELAGSADERSFYNTVWSTDNGVIS  609

Query  605  AAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDA  664
            A FGLARA+SA GDR  AVRTLDEVP TSRHFTTARLTSAVTLLSGRS+SE+TE+ IRDA
Sbjct  610  AGFGLARAQSAAGDRDAAVRTLDEVPATSRHFTTARLTSAVTLLSGRSSSEITEQHIRDA  669

Query  665  ARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSL  724
            ARRVEALP +EPRVLQIRALVLG A+DWL DN ASTNHILGFPFT HGL LGVEASLRSL
Sbjct  670  ARRVEALPDSEPRVLQIRALVLGTAMDWLADNTASTNHILGFPFTEHGLALGVEASLRSL  729

Query  725  ARVAPTQRHRYTLVDMANKVRPTSTF  750
            ARVAPTQ HRY LVD+AN VRP STF
Sbjct  730  ARVAPTQAHRYALVDLANSVRPMSTF  755


>gi|108797520|ref|YP_637717.1| serine/threonine protein kinase [Mycobacterium sp. MCS]
 gi|119866606|ref|YP_936558.1| serine/threonine protein kinase [Mycobacterium sp. KMS]
 gi|108767939|gb|ABG06661.1| serine/threonine protein kinase [Mycobacterium sp. MCS]
 gi|119692695|gb|ABL89768.1| serine/threonine protein kinase [Mycobacterium sp. KMS]
Length=759

 Score = 1200 bits (3104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/746 (80%), Positives = 661/746 (89%), Gaps = 9/746 (1%)

Query  12   PGTQPA---DAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDRMATTSRVR  68
            PGTQPA   D    +++TVRP++TQAVFRPDF D D+    T   DTEPQD   T  R  
Sbjct  16   PGTQPASLDDLDLDSASTVRPMATQAVFRPDFDDSDSISVHT--GDTEPQDHATTAIRTL  73

Query  69   PPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWC  128
             PVRRLGGGLVEIPR P  DPLEALMTNPVV E+KRFCWNCGRPVGRS S+ K  SEGWC
Sbjct  74   SPVRRLGGGLVEIPRVPAKDPLEALMTNPVVAENKRFCWNCGRPVGRSTSDGKALSEGWC  133

Query  129  PYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGD  188
            P+CGS YSFLPQLNPGD+VA QYE+KGCIAHGGLGW+YLA D NVN RPVVLKGLVHSGD
Sbjct  134  PHCGSQYSFLPQLNPGDMVADQYEIKGCIAHGGLGWVYLAFDHNVNERPVVLKGLVHSGD  193

Query  189  AEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKL  248
            AEAQA+AMAERQFLAEV HP IV+I+NFVEH D+HG+PVGYIVMEYVGG SLK+++GQ+L
Sbjct  194  AEAQAIAMAERQFLAEVTHPGIVKIYNFVEHEDKHGNPVGYIVMEYVGGTSLKQARGQRL  253

Query  249  PVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYG  308
            PVA+AI Y+LEILPAL YLHS+GL YNDLKPENIMLTE+Q+KLIDLGAVS INSFGYLYG
Sbjct  254  PVAQAIGYMLEILPALGYLHSLGLTYNDLKPENIMLTEDQVKLIDLGAVSTINSFGYLYG  313

Query  309  TPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGR  368
            TPG+QAPEIVRTGPTV +DIYTVGRTLAALTL+L TR GRYV+GLPEDDPVL  YDS+GR
Sbjct  314  TPGYQAPEIVRTGPTVQSDIYTVGRTLAALTLELRTRKGRYVEGLPEDDPVLAQYDSFGR  373

Query  369  LLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLV  428
            LLRRAIDPDPR+RF ++EEMS+QL GVLREVVA+DTGVPR GLST+FSP+RSTFG+DLLV
Sbjct  374  LLRRAIDPDPRRRFASSEEMSSQLLGVLREVVARDTGVPRSGLSTVFSPTRSTFGIDLLV  433

Query  429  AHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARH  488
            AHTDVY+DGQVH+EKLTA EIV AL VPLVDPTDV A+VL A+VLS+PVQTLD LRAARH
Sbjct  434  AHTDVYVDGQVHSEKLTAQEIVRALPVPLVDPTDVGAAVLSASVLSEPVQTLDQLRAARH  493

Query  489  GALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELL  548
            G+LD++G+D SESVELPLME RALLDLGDVAKATRKLDDLA RVGWRWRLVW+RAVAELL
Sbjct  494  GSLDSEGIDLSESVELPLMEARALLDLGDVAKATRKLDDLATRVGWRWRLVWFRAVAELL  553

Query  549  TGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEH----KFYQTVWSTNDGVIS  604
            + DY+SATKHFTEVLDT PGELAPKLALAATAELAG+  +H    KFY+TVW T+ G+IS
Sbjct  554  SADYESATKHFTEVLDTVPGELAPKLALAATAELAGSDLDHAPSRKFYETVWGTDHGIIS  613

Query  605  AAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDA  664
            A FGLARA SAEGDR GAVRTLDEVP TSRHFTTARLTSAVTLLSGRS++E+TE+QIRDA
Sbjct  614  AGFGLARALSAEGDRNGAVRTLDEVPATSRHFTTARLTSAVTLLSGRSSNEITEQQIRDA  673

Query  665  ARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSL  724
            ARRVEALP TEPRVLQIRALVLG A+DWL DN A+TNHILGFPFT +GL+LGVEASLR+L
Sbjct  674  ARRVEALPDTEPRVLQIRALVLGTAMDWLVDNSANTNHILGFPFTEYGLQLGVEASLRAL  733

Query  725  ARVAPTQRHRYTLVDMANKVRPTSTF  750
            ARVAPTQ HRY L+D+AN VRP STF
Sbjct  734  ARVAPTQAHRYALIDLANSVRPMSTF  759


>gi|315442240|ref|YP_004075119.1| serine/threonine protein kinase [Mycobacterium sp. Spyr1]
 gi|315260543|gb|ADT97284.1| serine/threonine protein kinase [Mycobacterium sp. Spyr1]
Length=766

 Score = 1199 bits (3101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/750 (81%), Positives = 660/750 (88%), Gaps = 10/750 (1%)

Query  11   GPGTQPA---DAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTL-GPDTEPQDRMATTSR  66
            GPGTQPA   D    + AT+RP++TQAVFRP F D+D+     +   DTEPQD   T +R
Sbjct  17   GPGTQPAGFADLADDSMATLRPMATQAVFRPHFDDDDDDSDALVHSGDTEPQDTATTITR  76

Query  67   VRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEG  126
               P RRLGGGLVEIPR P  DPL ALMT+PVV ESKRFCWNCGRPVGRS  + +  SEG
Sbjct  77   HLSPTRRLGGGLVEIPRVPARDPLAALMTDPVVAESKRFCWNCGRPVGRSTKDGRALSEG  136

Query  127  WCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHS  186
            WCP+CGS YSFLPQLNPGDIVA QYE+KGCIAHGGLGW+YLA D+NVN RPVVLKGLVHS
Sbjct  137  WCPHCGSAYSFLPQLNPGDIVADQYEIKGCIAHGGLGWVYLAFDKNVNDRPVVLKGLVHS  196

Query  187  GDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKR----  242
            GDAEAQA+AMAERQFLAEV HP IV+I+NFVEH D+HG+PVGYIVMEYVGG SLK+    
Sbjct  197  GDAEAQAIAMAERQFLAEVTHPGIVKIYNFVEHEDKHGNPVGYIVMEYVGGTSLKQATLL  256

Query  243  --SKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
              S   +LP AEAI ++LEILPAL YLHS+GLVYNDLKPENIM+TE+QLK+IDLGAVSRI
Sbjct  257  KHSSRIRLPAAEAIGFMLEILPALGYLHSLGLVYNDLKPENIMVTEDQLKIIDLGAVSRI  316

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPG+QAPEIVRTGPTVATDIYTVGRTLAALT+ LPTR GRY+DGLPED+PVL
Sbjct  317  NSFGYLYGTPGYQAPEIVRTGPTVATDIYTVGRTLAALTMRLPTRKGRYLDGLPEDNPVL  376

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            + YDS+GRLLRRAIDPDPR+RF TAEE+S+QL GVLREVVA DTGVPRPGLST+FSPSRS
Sbjct  377  EEYDSFGRLLRRAIDPDPRRRFQTAEELSSQLMGVLREVVASDTGVPRPGLSTMFSPSRS  436

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVH+EKLTA EIV AL VPLVDPTDV A+VL AT+LSQPVQTL
Sbjct  437  TFGVDLLVAHTDVYLDGQVHSEKLTAQEIVKALQVPLVDPTDVGATVLSATLLSQPVQTL  496

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRA RHGALD+DGVD S+SVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  497  DSLRAVRHGALDSDGVDLSQSVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  556

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            +RAV+ELLT DYDSATKHFT+VLDT PGELAPKLALAATAELAG +DE KFY+TVW T+ 
Sbjct  557  FRAVSELLTADYDSATKHFTQVLDTLPGELAPKLALAATAELAGASDERKFYKTVWDTDH  616

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISA FGLARA SAEGDR GAVRTL+EVP TSRHFTTARLTSAVTLLSGRSTSE+TEE 
Sbjct  617  GVISAGFGLARALSAEGDREGAVRTLNEVPATSRHFTTARLTSAVTLLSGRSTSEITEEH  676

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IR AARRVEALP TEPRVLQIRALVLG A+DWL DN ASTNHILGFPFT HGL+LGVEAS
Sbjct  677  IRSAARRVEALPDTEPRVLQIRALVLGTAMDWLADNTASTNHILGFPFTEHGLQLGVEAS  736

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQ HRY LVD+AN VRP STF
Sbjct  737  LRSLARVAPTQAHRYALVDLANSVRPMSTF  766


>gi|145220807|ref|YP_001131485.1| protein kinase [Mycobacterium gilvum PYR-GCK]
 gi|145213293|gb|ABP42697.1| serine/threonine protein kinase [Mycobacterium gilvum PYR-GCK]
Length=766

 Score = 1198 bits (3100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/750 (81%), Positives = 659/750 (88%), Gaps = 10/750 (1%)

Query  11   GPGTQPA---DAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTL-GPDTEPQDRMATTSR  66
            GPGTQPA   D    + AT+RP++TQAVFRP F D+D+     +   DTEPQD   T +R
Sbjct  17   GPGTQPAGFADLADDSMATLRPMATQAVFRPHFDDDDDDSDALVHSGDTEPQDAATTITR  76

Query  67   VRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEG  126
               P RRLGGGLVEIPR P  DPL ALMT+PVV ESKRFCWNCGRPVGRS  + +  SEG
Sbjct  77   HLSPTRRLGGGLVEIPRVPARDPLAALMTDPVVAESKRFCWNCGRPVGRSTKDGRALSEG  136

Query  127  WCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHS  186
            WCP+CGS YSFLPQLNPGDIVA QYE+KGCIAHGGLGW+YLA D+NVN RPVVLKGLVHS
Sbjct  137  WCPHCGSAYSFLPQLNPGDIVADQYEIKGCIAHGGLGWVYLAFDKNVNDRPVVLKGLVHS  196

Query  187  GDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKR----  242
            GDAEAQA+AMAERQFLAEV HP IV+I+NFVEH D+HG+PVGYIVMEYVGG SLK+    
Sbjct  197  GDAEAQAIAMAERQFLAEVTHPGIVKIYNFVEHEDKHGNPVGYIVMEYVGGTSLKQATLL  256

Query  243  --SKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
              S   +LP AEAI ++LEILPAL YLHS+GLVYNDLKPENIM+TE+QLK+IDLGAVSRI
Sbjct  257  KHSSRIRLPAAEAIGFMLEILPALGYLHSLGLVYNDLKPENIMVTEDQLKIIDLGAVSRI  316

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPG+QAPEIVRTGPTVATDIYTVGRTLAALT+ LPTR GRY+DGLPED+PVL
Sbjct  317  NSFGYLYGTPGYQAPEIVRTGPTVATDIYTVGRTLAALTMRLPTRKGRYLDGLPEDNPVL  376

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            + YDS+GRLLRRAIDPDPR+RF TAEE+S+QL GVLREVVA DTGVPRPGLST+FSPSRS
Sbjct  377  EEYDSFGRLLRRAIDPDPRRRFQTAEELSSQLMGVLREVVASDTGVPRPGLSTMFSPSRS  436

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVH+EKLTA EIV AL VPLVDPTDV A+VL AT+LSQPVQTL
Sbjct  437  TFGVDLLVAHTDVYLDGQVHSEKLTAQEIVKALQVPLVDPTDVGATVLSATLLSQPVQTL  496

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRA RHGALD+DGVD S+SVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  497  DSLRAVRHGALDSDGVDLSQSVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  556

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
            +RAV+ELLT DYDSATKHFT+VLDT PGELAPKLALAATAELAG +DE  FY+TVW T+ 
Sbjct  557  FRAVSELLTADYDSATKHFTQVLDTLPGELAPKLALAATAELAGASDERTFYKTVWDTDH  616

Query  601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
            GVISA FGLARA SAEGDR GAVRTLDEVP TSRHFTTARLTSAVTLLSGRSTSE+TEE 
Sbjct  617  GVISAGFGLARALSAEGDREGAVRTLDEVPATSRHFTTARLTSAVTLLSGRSTSEITEEH  676

Query  661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
            IR AARRVEALP TEPRVLQIRALVLG A+DWL DN ASTNHILGFPFT HGL+LGVEAS
Sbjct  677  IRSAARRVEALPDTEPRVLQIRALVLGTAMDWLADNTASTNHILGFPFTEHGLQLGVEAS  736

Query  721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            LRSLARVAPTQ HRY LVD+AN VRP STF
Sbjct  737  LRSLARVAPTQAHRYALVDLANSVRPMSTF  766


>gi|118468912|ref|YP_885191.1| serine/threonine protein kinase [Mycobacterium smegmatis str. 
MC2 155]
 gi|118170199|gb|ABK71095.1| serine/threonine protein kinase [Mycobacterium smegmatis str. 
MC2 155]
Length=760

 Score = 1197 bits (3098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/744 (80%), Positives = 660/744 (89%), Gaps = 5/744 (0%)

Query  10   SGPGTQPA---DAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDRMATTSR  66
            SGPGTQPA   D    +++T+RP++TQAV+RP+F D D     T+   TE  D++   +R
Sbjct  19   SGPGTQPASLEDLDMDSASTMRPMATQAVYRPEFDDTDGTSRGTVV--TEAYDQVTMATR  76

Query  67   VRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEG  126
               P+RRLGGGLVEIPR P+ DPL ALMTNPVV ESKRFCWNCG+PVGRS  + +  SEG
Sbjct  77   ALSPMRRLGGGLVEIPRVPERDPLTALMTNPVVAESKRFCWNCGKPVGRSTPDGRALSEG  136

Query  127  WCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHS  186
            WCP+CGSPYSFLPQL+PGDIVA QYE+KGCIAHGGLGW+YLA D+NVN RPVVLKGLVHS
Sbjct  137  WCPHCGSPYSFLPQLSPGDIVADQYEIKGCIAHGGLGWVYLAFDKNVNDRPVVLKGLVHS  196

Query  187  GDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQ  246
            GDAEAQA+AMAERQFLAEV HP IV+I+NFVEH D+HG+PVGYIVMEYVGG SLK+++G 
Sbjct  197  GDAEAQAIAMAERQFLAEVTHPGIVKIYNFVEHEDKHGNPVGYIVMEYVGGTSLKQARGA  256

Query  247  KLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYL  306
            KLPVAEAI Y+LEILPAL YLHSIGL YNDLKPENIM+TEEQLKLIDLGAVSR+NS+GYL
Sbjct  257  KLPVAEAIGYMLEILPALGYLHSIGLAYNDLKPENIMITEEQLKLIDLGAVSRLNSYGYL  316

Query  307  YGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSY  366
            YGTPG+QAPEIVRTGPTVATDIYTVGRTLAALTL L TR GRYVDGLP DDPVL+TYDSY
Sbjct  317  YGTPGYQAPEIVRTGPTVATDIYTVGRTLAALTLSLRTRRGRYVDGLPSDDPVLETYDSY  376

Query  367  GRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDL  426
             RLLRRAIDPDPR+RFT+AEEMS+QL GVLREVVA DTGVPRPGLST+FSPSRSTFGVDL
Sbjct  377  HRLLRRAIDPDPRRRFTSAEEMSSQLLGVLREVVATDTGVPRPGLSTVFSPSRSTFGVDL  436

Query  427  LVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAA  486
            LVAHTDVY+DGQVH+EKLTA EIV AL VPLVD TDV A +L A+VLS+PV TLD LRAA
Sbjct  437  LVAHTDVYVDGQVHSEKLTAQEIVRALPVPLVDRTDVGAPMLVASVLSEPVHTLDQLRAA  496

Query  487  RHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAE  546
            RHGALD +G+D +ESVELPLMEVRALLDLGDVAKATRKL+DLA RVGWRWRLVW++AV+E
Sbjct  497  RHGALDTEGIDLNESVELPLMEVRALLDLGDVAKATRKLEDLAARVGWRWRLVWFKAVSE  556

Query  547  LLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAA  606
            +L+ DYDSATKHFTEVLDT PGELAPKLALAATAELAG  DE KFY+TVWST++GVISA 
Sbjct  557  MLSADYDSATKHFTEVLDTLPGELAPKLALAATAELAGTADELKFYKTVWSTDNGVISAG  616

Query  607  FGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAAR  666
            FGLARA+S  G+R  AV+TLDEVPPTSRHFTTARLTSAVTLLSGRSTSE+TE+ IRDAAR
Sbjct  617  FGLARAQSVAGERDMAVQTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEITEQHIRDAAR  676

Query  667  RVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLAR  726
            RVEALP +EPRVLQIRALVLG ALDWL DN AS+NHILGFPFT HGL+LGVEASLR+LAR
Sbjct  677  RVEALPDSEPRVLQIRALVLGTALDWLADNTASSNHILGFPFTEHGLKLGVEASLRALAR  736

Query  727  VAPTQRHRYTLVDMANKVRPTSTF  750
            +APTQ HRY LVD+AN VRP STF
Sbjct  737  IAPTQSHRYALVDLANSVRPMSTF  760


>gi|126433142|ref|YP_001068833.1| serine/threonine protein kinase [Mycobacterium sp. JLS]
 gi|126232942|gb|ABN96342.1| serine/threonine protein kinase [Mycobacterium sp. JLS]
Length=759

 Score = 1197 bits (3098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/746 (80%), Positives = 660/746 (89%), Gaps = 9/746 (1%)

Query  12   PGTQPA---DAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDRMATTSRVR  68
            PGTQPA   D    +++TVRP++TQAVFRPDF D D+    T   DTE QD   T  R  
Sbjct  16   PGTQPASLDDLDLDSASTVRPMATQAVFRPDFDDSDSISVHT--GDTEAQDHATTAIRTL  73

Query  69   PPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWC  128
             PVRRLGGGLVEIPR P  DPLEALMTNPVV E+KRFCWNCGRPVGRS S+ K  SEGWC
Sbjct  74   SPVRRLGGGLVEIPRVPAKDPLEALMTNPVVAENKRFCWNCGRPVGRSTSDGKALSEGWC  133

Query  129  PYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGD  188
            P+CGS YSFLPQLNPGD+VA QYE+KGCIAHGGLGW+YLA D NVN RPVVLKGLVHSGD
Sbjct  134  PHCGSQYSFLPQLNPGDMVADQYEIKGCIAHGGLGWVYLAFDHNVNERPVVLKGLVHSGD  193

Query  189  AEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKL  248
            AEAQA+AMAERQFLAEV HP IV+I+NFVEH D+HG+PVGYIVMEYVGG SLK+++GQ+L
Sbjct  194  AEAQAIAMAERQFLAEVTHPGIVKIYNFVEHEDKHGNPVGYIVMEYVGGTSLKQARGQRL  253

Query  249  PVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYG  308
            PVA+AI Y+LEILPAL YLHS+GL YNDLKPENIMLTE+Q+KLIDLGAVS INSFGYLYG
Sbjct  254  PVAQAIGYMLEILPALGYLHSLGLTYNDLKPENIMLTEDQVKLIDLGAVSTINSFGYLYG  313

Query  309  TPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGR  368
            TPG+QAPEIVRTGPTV +DIYTVGRTLAALTL+L TR GRYV+GLPEDDPVL  YDS+GR
Sbjct  314  TPGYQAPEIVRTGPTVQSDIYTVGRTLAALTLELRTRKGRYVEGLPEDDPVLAQYDSFGR  373

Query  369  LLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLV  428
            LLRRAIDPDPR+RF ++EEMS+QL GVLREVVA+DTGVPR GLST+FSP+RSTFG+DLLV
Sbjct  374  LLRRAIDPDPRRRFASSEEMSSQLLGVLREVVARDTGVPRSGLSTVFSPTRSTFGIDLLV  433

Query  429  AHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARH  488
            AHTDVY+DGQVH+EKLTA EIV AL VPLVDPTDV A+VL A+VLS+PVQTLD LRAARH
Sbjct  434  AHTDVYVDGQVHSEKLTAQEIVRALPVPLVDPTDVGAAVLSASVLSEPVQTLDQLRAARH  493

Query  489  GALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELL  548
            G+LD++G+D SESVELPLME RALLDLGDVAKATRKLDDLA RVGWRWRLVW+RAVAELL
Sbjct  494  GSLDSEGIDLSESVELPLMEARALLDLGDVAKATRKLDDLATRVGWRWRLVWFRAVAELL  553

Query  549  TGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEH----KFYQTVWSTNDGVIS  604
            + DY+SATKHFTEVLDT PGELAPKLALAATAELAG+  +H    KFY+TVW T+ G+IS
Sbjct  554  SADYESATKHFTEVLDTVPGELAPKLALAATAELAGSDLDHAPSRKFYETVWGTDHGIIS  613

Query  605  AAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDA  664
            A FGLARA SAEGDR GAVRTLDEVP TSRHFTTARLTSAVTLLSGRS++E+TE+QIRDA
Sbjct  614  AGFGLARALSAEGDRNGAVRTLDEVPATSRHFTTARLTSAVTLLSGRSSNEITEQQIRDA  673

Query  665  ARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSL  724
            ARRVEALP TEPRVLQIRALVLG A+DWL DN A+TNHILGFPFT +GL+LGVEASLR+L
Sbjct  674  ARRVEALPDTEPRVLQIRALVLGTAMDWLVDNSANTNHILGFPFTEYGLQLGVEASLRAL  733

Query  725  ARVAPTQRHRYTLVDMANKVRPTSTF  750
            ARVAPTQ HRY L+D+AN VRP STF
Sbjct  734  ARVAPTQAHRYALIDLANSVRPMSTF  759


>gi|289748895|ref|ZP_06508273.1| serine/threonine protein kinase [Mycobacterium tuberculosis T92]
 gi|289689482|gb|EFD56911.1| serine/threonine protein kinase [Mycobacterium tuberculosis T92]
Length=608

 Score = 1170 bits (3027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/573 (100%), Positives = 573/573 (100%), Gaps = 0/573 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  27   MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  86

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  87   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  146

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  147  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  206

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL
Sbjct  207  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  266

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  267  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  326

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  327  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  386

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  387  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  446

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  447  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  506

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  507  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  566

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPK  573
            YRAVAELLTGDYDSATKHFTEVLDTFPGELAPK
Sbjct  567  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPK  599


>gi|333989021|ref|YP_004521635.1| serine/threonine-protein kinase [Mycobacterium sp. JDM601]
 gi|333484989|gb|AEF34381.1| serine/threonine-protein kinase PknG [Mycobacterium sp. JDM601]
Length=757

 Score = 1166 bits (3017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/749 (76%), Positives = 640/749 (86%), Gaps = 7/749 (0%)

Query  2    AKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDRM  61
            A+  + + +GP TQ AD    +S+  RP+STQA+FRP  G              +   R+
Sbjct  16   AEFDDFDDNGPATQRADVLAESSSVRRPMSTQAIFRPREGSNAAI-------SADDDSRV  68

Query  62   ATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETK  121
            A   R   P RRLGGGLVEIPR P+I+PLEALM +PVV E+KRFCWNCGRPVGRS  + K
Sbjct  69   AAVVRTVAPRRRLGGGLVEIPRVPEINPLEALMPDPVVAEAKRFCWNCGRPVGRSTGDVK  128

Query  122  GASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLK  181
            GASEGWCP+CGSPYSFLPQL PGD+VAGQYE+KGC+AHGGLGW+YLA+D NVN RPVVLK
Sbjct  129  GASEGWCPHCGSPYSFLPQLKPGDMVAGQYEIKGCVAHGGLGWVYLAVDHNVNERPVVLK  188

Query  182  GLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLK  241
            GLVHSGDAEAQA+AMAERQFLAEV HPSIV+IFNFV+H D HGDPVGYIVMEYVGGQSLK
Sbjct  189  GLVHSGDAEAQAIAMAERQFLAEVTHPSIVKIFNFVQHPDSHGDPVGYIVMEYVGGQSLK  248

Query  242  RSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRIN  301
            + +  +LPVA+AIAY+LEILPAL YLHS+GLVYNDLKPENI+LT EQLKLIDLGAVSRIN
Sbjct  249  QRRDSRLPVAQAIAYMLEILPALGYLHSLGLVYNDLKPENIVLTAEQLKLIDLGAVSRIN  308

Query  302  SFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLK  361
            SFGYLYGTPG+QAP+IVRTGPTVATDIYTVGRTLAALTL L TR GRYVDGLP+DDPVL 
Sbjct  309  SFGYLYGTPGYQAPDIVRTGPTVATDIYTVGRTLAALTLKLRTREGRYVDGLPDDDPVLA  368

Query  362  TYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRST  421
             YDSY RLLRRAIDPDPR+RFT+AEEMS+QL GVLREVVA+DTG+PRPGLS++F+ SRST
Sbjct  369  KYDSYHRLLRRAIDPDPRRRFTSAEEMSSQLMGVLREVVARDTGIPRPGLSSVFTRSRST  428

Query  422  FGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLD  481
            FG  LLVAHTDVYLDG VH++ LTA EI+TAL VPL+DP DVAA +L +  LS+PVQTLD
Sbjct  429  FGEHLLVAHTDVYLDGHVHSQNLTAREIITALQVPLIDPGDVAAPLLTSMELSEPVQTLD  488

Query  482  SLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWY  541
            SLRA R+ AL+++G+D SES+ LPLMEVRALLDLG+V KA  KLDDLAE+VGWRWRLVW+
Sbjct  489  SLRAVRNSALESEGIDLSESIGLPLMEVRALLDLGNVTKAASKLDDLAEQVGWRWRLVWF  548

Query  542  RAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDG  601
            R VA+LLTGDY++A K FTEVLD FPGELAPK+ALAATAELAG  DE  FY++VW T+D 
Sbjct  549  RGVAQLLTGDYEAARKDFTEVLDMFPGELAPKMALAATAELAGTADERAFYESVWRTDDS  608

Query  602  VISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQI  661
            VISAAFGLARA S EGDR  AVRTLDEV  TSRHFTTARLTSAVTLLSG S +E+TE QI
Sbjct  609  VISAAFGLARALSVEGDRTAAVRTLDEVSATSRHFTTARLTSAVTLLSGPSKNEITEAQI  668

Query  662  RDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASL  721
            RDAARRVEALP TEPRVLQIRALVLG A+DWL +++ASTNHILGFPFT HGLRLGVE +L
Sbjct  669  RDAARRVEALPDTEPRVLQIRALVLGAAMDWLTEHEASTNHILGFPFTEHGLRLGVEMAL  728

Query  722  RSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            R+LAR+APTQ HRY LVDMAN VRP STF
Sbjct  729  RALARLAPTQAHRYALVDMANAVRPMSTF  757


>gi|289756479|ref|ZP_06515857.1| serine/threonine-protein kinase PknG [Mycobacterium tuberculosis 
T85]
 gi|289712043|gb|EFD76055.1| serine/threonine-protein kinase PknG [Mycobacterium tuberculosis 
T85]
Length=581

 Score = 1109 bits (2869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/567 (99%), Positives = 557/567 (99%), Gaps = 0/567 (0%)

Query  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60
            MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR
Sbjct  1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR  60

Query  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
            MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET
Sbjct  61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120

Query  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
            KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL
Sbjct  121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180

Query  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
            KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEY+GG SL
Sbjct  181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYIGGHSL  240

Query  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
            KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
Sbjct  241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
            NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL
Sbjct  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360

Query  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
            KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS
Sbjct  361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420

Query  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
            TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL
Sbjct  421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480

Query  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW
Sbjct  481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFP  567
            YRAVAELLTGDYDSAT         FP
Sbjct  541  YRAVAELLTGDYDSATNISPRCWIPFP  567


>gi|169631302|ref|YP_001704951.1| serine/threonine-protein kinase [Mycobacterium abscessus ATCC 
19977]
 gi|169243269|emb|CAM64297.1| Probable serine/threonine-protein kinase [Mycobacterium abscessus]
Length=753

 Score = 1102 bits (2849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/741 (73%), Positives = 614/741 (83%), Gaps = 8/741 (1%)

Query  11   GPGTQPA---DAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDRMATTSRV  67
            GPGTQPA   D    +++T+RP+ST+AVFRP      +   P   P T+P+ R  TT  +
Sbjct  16   GPGTQPASLADLDVDSASTMRPISTRAVFRPP-----DSTQPATQPTTQPEVRATTTRVL  70

Query  68   RPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGW  127
              P RRLGGGLVEIPR P+IDPLEALMTNPVV ESKRFCWNCG+PVGRS +++   SEG 
Sbjct  71   LSPTRRLGGGLVEIPRVPEIDPLEALMTNPVVEESKRFCWNCGKPVGRSTTDSPAQSEGI  130

Query  128  CPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSG  187
            CP CGS +SFLPQLNPGD++AGQY +KGCIAHGGLGWIYLA+DRNVN RPVVLKGLVHSG
Sbjct  131  CPTCGSSFSFLPQLNPGDVIAGQYAIKGCIAHGGLGWIYLAVDRNVNDRPVVLKGLVHSG  190

Query  188  DAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQK  247
            DAEAQ +AMAER+FLAEV HPSIV+IFNFVEH D+HG+PVGYIVMEYVGG SLK+ KG  
Sbjct  191  DAEAQNIAMAERRFLAEVAHPSIVKIFNFVEHPDQHGNPVGYIVMEYVGGTSLKQPKGNA  250

Query  248  LPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLY  307
            LPVA+AIAY+LEILPAL +LHS+GL YNDLKPENIM+TEEQLKLIDLGAV+ IN++G LY
Sbjct  251  LPVAQAIAYMLEILPALGFLHSVGLTYNDLKPENIMITEEQLKLIDLGAVASINAYGNLY  310

Query  308  GTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYG  367
            GTPG+QAPEI +TGPTVA+DIYTVGRTLA LTL +PTR GRY DGLP DDPVL  YDSY 
Sbjct  311  GTPGYQAPEISKTGPTVASDIYTVGRTLAVLTLRMPTRKGRYKDGLPSDDPVLAKYDSYH  370

Query  368  RLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLL  427
            R LRRAIDPDP  RF +AEEM+ QL GVLREVVA D+G PRPG+ST+FSPSRSTFGVDLL
Sbjct  371  RFLRRAIDPDPSARFGSAEEMATQLVGVLREVVALDSGTPRPGMSTLFSPSRSTFGVDLL  430

Query  428  VAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAAR  487
            VAHTDVY+DG  H   LTA +IVTAL VPL+DPTDV A++LQATVLSQP+QTL+SL+AAR
Sbjct  431  VAHTDVYVDGLAHPPSLTAPDIVTALQVPLLDPTDVGAAILQATVLSQPIQTLESLKAAR  490

Query  488  HGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAEL  547
             G +DADGVD +ESVELPLME RALLDLGDVAKA  KLD L +RVG  WRL WYR +A L
Sbjct  491  LGRIDADGVDLTESVELPLMEARALLDLGDVAKANSKLDQLEDRVGTPWRLTWYRGMAAL  550

Query  548  LTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAF  607
            L GDYD ATKHFT VLD  PGE+APK+ALAATAELAG+     FY+TVWST++ VISA +
Sbjct  551  LNGDYDQATKHFTAVLDFLPGEIAPKMALAATAELAGDEKNLDFYRTVWSTDNSVISAGY  610

Query  608  GLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARR  667
            GLAR  +A G+R  AVR LD VPPTSRHFTTARLTSAVTLLSGR+ SEVTE+ IR+AARR
Sbjct  611  GLARTLAARGERAEAVRMLDNVPPTSRHFTTARLTSAVTLLSGRTLSEVTEDDIREAARR  670

Query  668  VEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARV  727
            VEALP TEPRVLQIRALVLG ALDW+K N ++ +HILG PFT  GLR GVE  LR+LAR 
Sbjct  671  VEALPETEPRVLQIRALVLGTALDWIKSNHSTGHHILGVPFTKRGLRQGVERCLRALARR  730

Query  728  APTQRHRYTLVDMANKVRPTS  748
            A  + HRY LVD+AN  RPTS
Sbjct  731  ATERAHRYALVDLANATRPTS  751


>gi|339297106|gb|AEJ49216.1| serine/threonine protein kinase [Mycobacterium tuberculosis CCDC5180]
Length=564

 Score = 1095 bits (2832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/547 (100%), Positives = 547/547 (100%), Gaps = 0/547 (0%)

Query  204  EVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKLPVAEAIAYLLEILPA  263
            EVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKLPVAEAIAYLLEILPA
Sbjct  18   EVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKLPVAEAIAYLLEILPA  77

Query  264  LSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPT  323
            LSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPT
Sbjct  78   LSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPT  137

Query  324  VATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFT  383
            VATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFT
Sbjct  138  VATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFT  197

Query  384  TAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEK  443
            TAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEK
Sbjct  198  TAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEK  257

Query  444  LTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSESVE  503
            LTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSESVE
Sbjct  258  LTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSESVE  317

Query  504  LPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVL  563
            LPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVL
Sbjct  318  LPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVL  377

Query  564  DTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAV  623
            DTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAV
Sbjct  378  DTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAV  437

Query  624  RTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRA  683
            RTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRA
Sbjct  438  RTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRA  497

Query  684  LVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANK  743
            LVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANK
Sbjct  498  LVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANK  557

Query  744  VRPTSTF  750
            VRPTSTF
Sbjct  558  VRPTSTF  564


>gi|111019188|ref|YP_702160.1| serine/threonine-protein kinase [Rhodococcus jostii RHA1]
 gi|110818718|gb|ABG94002.1| serine/threonine-protein kinase [Rhodococcus jostii RHA1]
Length=773

 Score =  790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/763 (56%), Positives = 523/763 (69%), Gaps = 35/763 (4%)

Query  18   DAQTATSATVRP---LSTQAVFRPDFGDEDNFPHPTLGPDTEPQDRMATTSRVRPPVRR-  73
            D   AT A VR     +TQA  R +    D  P     P + P     T    R P  R 
Sbjct  12   DPDIATQAAVREPEEEATQAAVREE---PDEGPATQATPTSRPSGASGTGRSTRSPRTRS  68

Query  74   -----LGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWC  128
                 LGGGLVE+P    +DP  A+MT+P VPESKRFCW C +PVGR+ + ++G+  G C
Sbjct  69   GQRLRLGGGLVEVPVVKTLDPASAVMTDPKVPESKRFCWKCNKPVGRTSATSEGSEFGLC  128

Query  129  PYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGD  188
            P CG+ Y F P L P + + GQYEV+GCIAHGGLGWIYLA+DRNV+ R VVLKGL+H GD
Sbjct  129  PSCGATYDFRPLLGPNEFIGGQYEVQGCIAHGGLGWIYLAIDRNVSDRWVVLKGLLHFGD  188

Query  189  AEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLK-----RS  243
            AEAQA+A+AERQFLAEV HPSIV+IFNFVEH    G P+GYIVMEYVGG SL+       
Sbjct  189  AEAQAVAVAERQFLAEVAHPSIVKIFNFVEHPRSDGTPMGYIVMEYVGGHSLRDVLSTHE  248

Query  244  KGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSF  303
            K +++PV +AIAY+LEILPAL+YLHS GLVYNDLKP+N+M+TE+ LKLIDLGAV+ I  +
Sbjct  249  KPERMPVEQAIAYVLEILPALAYLHSTGLVYNDLKPDNVMVTEDALKLIDLGAVAGIEDY  308

Query  304  GYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGL--PEDDPVLK  361
            GYLYGTPGFQAPEIV+TGPTVA+DIYTVGRTLA LTLD+P+  GRY+DG+  PE  P+L 
Sbjct  309  GYLYGTPGFQAPEIVKTGPTVASDIYTVGRTLAVLTLDMPSDKGRYLDGIPSPEQAPLLA  368

Query  362  TYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRST  421
             Y+ + RLL RA DPDP +RF +AEEM+ QLT VLREV+AQ TG   PGLST+FS  R+T
Sbjct  369  EYEFFHRLLLRATDPDPSRRFASAEEMAGQLTAVLREVLAQQTGEEHPGLSTVFSKQRTT  428

Query  422  FGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLD  481
            FG +  V  TDVY+DG    E L  + +  AL+VPL+DPTD  A +L A V S+P QTL+
Sbjct  429  FGTNEAVEQTDVYVDGVERDENLDPHSVAQALAVPLIDPTDPNAPLLAAAVHSEPQQTLE  488

Query  482  SLRAARHGALD--ADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLV  539
            S+R AR   ++     +D S S EL L E++A LDLGD A AT  L  +   +G  WR+ 
Sbjct  489  SIRHARENGIERVVGDLDVSFSRELTLAEIKAHLDLGDAATATELLRAVEGDMGGNWRVD  548

Query  540  WYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELA----GNTDEH------  589
            WY  +A L+ G+Y++A   F  VL   PGE APKLALAATAEL      ++D H      
Sbjct  549  WYAGLATLIDGEYETAFSRFESVLKAMPGETAPKLALAATAELILQHWESSDPHQWRTFA  608

Query  590  -KFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLL  648
             K+Y+TVW T+  ++SAAFGLAR  +  GD  GA+  LD+VP TSRHFT AR+TS + LL
Sbjct  609  EKYYRTVWRTDHSMVSAAFGLARQLTQRGDLPGAIAALDQVPATSRHFTMARMTSVLMLL  668

Query  649  SGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKAST---NHILG  705
            SG+   E+ E  +R+AA RV AL P E R LQ+R LVLG ALDW++    S      ILG
Sbjct  669  SGKPIEEIDEAALREAALRVAALAPEESRALQMRTLVLGTALDWMRAGHTSATEREQILG  728

Query  706  FPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTS  748
             PFT  GLR G EA LR+LAR AP + HRYTLVD+AN +RP S
Sbjct  729  VPFTERGLRKGAEAGLRALARNAPERTHRYTLVDLANAIRPKS  771


>gi|226361324|ref|YP_002779102.1| serine/threonine protein kinase PknG [Rhodococcus opacus B4]
 gi|226239809|dbj|BAH50157.1| serine/threonine protein kinase PknG [Rhodococcus opacus B4]
Length=773

 Score =  781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/766 (55%), Positives = 517/766 (68%), Gaps = 35/766 (4%)

Query  15   QPADAQTATSATVRP---LSTQAVFRPDFGDEDNFPHPTLGPDTEPQDRMATTSRVRPPV  71
            +  D   AT A VR     +T+A  R +    D  P     P + P     T    R P 
Sbjct  9    ESTDQDLATQAAVREPEDEATRAAVREEL---DEGPATQAAPTSRPSGASGTGRSTRSPR  65

Query  72   RR------LGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASE  125
             R      LGGGLVE+P    +DP  A+MT+P VPE KRFCW C +PVGR  S ++ +  
Sbjct  66   TRSGQRLRLGGGLVEVPVVTTLDPASAVMTDPKVPEGKRFCWKCNKPVGRGSSTSEASEF  125

Query  126  GWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVH  185
            G CP CG+ + F P L+P +++ GQYEV+GCIAHGGLGWIYLA+DRNV+ R VVLKGL+H
Sbjct  126  GLCPSCGATFDFRPLLDPNELIGGQYEVQGCIAHGGLGWIYLAIDRNVSDRWVVLKGLLH  185

Query  186  SGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLK----  241
             GDAEAQA+A+AERQFLAEV HPSIV+IFNFVEH    G P+GYIVMEYVGG SL+    
Sbjct  186  FGDAEAQAVAVAERQFLAEVAHPSIVKIFNFVEHPRADGTPMGYIVMEYVGGHSLRDVLS  245

Query  242  -RSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
              ++ +++PV +AIAY+LEILPAL+YLHS GLVYNDLKP+N+M+TE+ LKLIDLGAV+ I
Sbjct  246  THTRPERMPVEQAIAYVLEILPALAYLHSTGLVYNDLKPDNVMVTEDALKLIDLGAVAGI  305

Query  301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGL--PEDDP  358
              +GYLYGTPG+QAPEIV+TGPTVA+DIYTVGRTLA LTLD+P+  GRY+DG+  PE  P
Sbjct  306  EDYGYLYGTPGYQAPEIVKTGPTVASDIYTVGRTLAVLTLDMPSDKGRYLDGIPSPEKAP  365

Query  359  VLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPS  418
            +L  Y+ + RLL RA DPDP +RF +AEEM+ QLT VLREV+AQ TG   PGLST+FS  
Sbjct  366  LLAEYEFFHRLLLRATDPDPSRRFASAEEMAGQLTAVLREVLAQQTGEEHPGLSTVFSKQ  425

Query  419  RSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQ  478
            R+TFG D  V  TDVY+DG      L    +  AL+VPL+DP D  A +L A V S+P Q
Sbjct  426  RTTFGTDDAVEQTDVYVDGVERDRNLDPQSVAQALAVPLIDPADPNAPLLAAAVHSEPQQ  485

Query  479  TLDSLRAARHGALD--ADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRW  536
            TLDS+R AR   ++     +D S S EL L E++A LDLGD A AT  L DL       W
Sbjct  486  TLDSIRHARENGIERVVGDLDVSFSRELTLAEMKAHLDLGDAATATTLLRDLETETVGNW  545

Query  537  RLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAEL----AGNTDEH---  589
            R+ WY  +  L+ G+Y++A   F  VL   PGE APKLALAATAEL      ++D H   
Sbjct  546  RVDWYAGLTTLIDGEYETAFSRFESVLQAMPGETAPKLALAATAELILQHCDSSDSHRWR  605

Query  590  ----KFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAV  645
                K+Y+TVW T+  ++SAAFGLAR  +  GD  GA+  LD+VP TSRHFT AR+TS +
Sbjct  606  TFAEKYYRTVWRTDHSLVSAAFGLARQLTERGDLPGAIAALDQVPVTSRHFTMARMTSVL  665

Query  646  TLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKAST---NH  702
             LLSGR   E+ E  +R AA RV AL P E R LQ+R LVLG ALDW +    S      
Sbjct  666  MLLSGRPIEEIDESALRQAALRVTALAPEESRALQMRTLVLGTALDWTRAGHTSATELEQ  725

Query  703  ILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTS  748
            ILG PFT  GLR G EA LR+LAR AP + HRYTLVD+AN +RP S
Sbjct  726  ILGVPFTERGLRKGAEAGLRALARNAPERTHRYTLVDLANAIRPRS  771


>gi|229493048|ref|ZP_04386843.1| serine/threonine protein kinase [Rhodococcus erythropolis SK121]
 gi|229320078|gb|EEN85904.1| serine/threonine protein kinase [Rhodococcus erythropolis SK121]
Length=775

 Score =  776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/701 (57%), Positives = 500/701 (72%), Gaps = 23/701 (3%)

Query  73   RLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYCG  132
            RLGGGLVE+P  P IDP  A+M++P VPE KRFCW C  PVGR  + TK    G CP CG
Sbjct  75   RLGGGLVEVPPVPQIDPASAVMSDPTVPERKRFCWKCNEPVGRKSASTKATQHGTCPKCG  134

Query  133  SPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQ  192
            S + F P L  G++V+GQYEV+G IAHGGLGWIYLA+DRNV+ R VVLKGL+H GD+EAQ
Sbjct  135  STFDFRPLLEEGELVSGQYEVQGPIAHGGLGWIYLAIDRNVSDRWVVLKGLLHFGDSEAQ  194

Query  193  AMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKR-----SKGQK  247
            A+A+AERQFLAEV +PSIV+IFNFVEH    G P+GYIVMEYVGG+SL+        G+ 
Sbjct  195  AVAVAERQFLAEVANPSIVKIFNFVEHPRPDGTPMGYIVMEYVGGRSLREVLAEFPDGKH  254

Query  248  LPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLY  307
            +P+ +AI Y+LEILPALSYLHS GL YNDLKPEN+M+TE+QLKLIDLGAVS I  +GYLY
Sbjct  255  MPIEQAIGYVLEILPALSYLHSTGLAYNDLKPENVMVTEDQLKLIDLGAVSGIEDYGYLY  314

Query  308  GTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGL--PEDDPVLKTYDS  365
            GT G+QAPEI+ TGPT+A+DI+TVGRTLA LTLD+P+++GRY+DGL  PED+P+L+ ++ 
Sbjct  315  GTAGYQAPEIIETGPTIASDIFTVGRTLAVLTLDMPSKHGRYLDGLPEPEDEPLLRDHEF  374

Query  366  YGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVD  425
            + RLL RA DPDP++RF +AEE++ QLTGVLRE++A+ TG   PGLS +FS  R++FG D
Sbjct  375  FHRLLLRATDPDPKKRFQSAEEIAGQLTGVLREILAEQTGQENPGLSLVFSRQRTSFGTD  434

Query  426  LLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRA  485
             LV  TDVY+DG  H   L   E+  AL +PLVDPTD +A +L A V S+P QTLD+L+ 
Sbjct  435  ELVGQTDVYVDGVSHDAALDPREVAHALPIPLVDPTDPSAPLLAAAVHSEPSQTLDALKH  494

Query  486  ARHGALDADGVDFSESV--ELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRA  543
            AR   +D      + +V  E+ L E +A LDLGD   A   L +L + +G  W++ WYR 
Sbjct  495  ARENGIDRTSGTPAAAVSGEVRLAEAKAHLDLGDPETALTVLGELQQNIGDHWKIEWYRG  554

Query  544  VAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAEL------AGNTDE-----HKFY  592
            +A L    ++ A  HF  VL   PGE APKLALAATAEL      + + D+      K+Y
Sbjct  555  LAALQLDRFEPAFSHFETVLTALPGEAAPKLALAATAELILQHWESDDPDQWCRFSEKYY  614

Query  593  QTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRS  652
            +TVW T    +SAAFGLAR  +  G++  A+  LDEVP +SRH+  AR++SA+T+LSG  
Sbjct  615  RTVWRTERNYVSAAFGLARQLADHGNKKAAIAALDEVPTSSRHYNVARMSSALTMLSGVP  674

Query  653  TSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLK-DNKAST--NHILGFPFT  709
             +E+ E  +R+AARRV ALP  E R LQ+R LVLG ALDW++  N++ T    IL  PFT
Sbjct  675  IAELDESTLREAARRVRALPAEESRSLQMRTLVLGTALDWIRYGNRSHTELEPILDLPFT  734

Query  710  SHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
              GLR G EA LR+LAR   ++ HRY LVD AN VRP S F
Sbjct  735  EQGLRTGAEACLRALARATTSRTHRYALVDRANAVRPRSNF  775


>gi|226304963|ref|YP_002764921.1| serine/threonine protein kinase PknG [Rhodococcus erythropolis 
PR4]
 gi|226184078|dbj|BAH32182.1| probable serine/threonine protein kinase PknG [Rhodococcus erythropolis 
PR4]
Length=785

 Score =  775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/791 (54%), Positives = 531/791 (68%), Gaps = 54/791 (6%)

Query  7    TERSGPGTQPADAQTATSATVRPL--STQAVFR-PDFGD-------EDNFPHPTLGPDTE  56
            TE SGP  +P     AT A+VRP   STQAV R PD          E    +  L P T 
Sbjct  2    TEESGP--EP----DATQASVRPEPDSTQAVHREPDSTQASLRSEPEATGAYERLEP-TS  54

Query  57   PQDRMATTSRVRPPVR--------------RLGGGLVEIPRAPDIDPLEALMTNPVVPES  102
             Q R  T S    P                RLGGGLVE+P  P IDP  A+M++P VPE 
Sbjct  55   AQIRGTTPSASSSPTGRSTRSRRSRSGRKLRLGGGLVEVPPVPQIDPASAVMSDPTVPER  114

Query  103  KRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGL  162
            KRFCW C  PVGR  + T+    G CP CGS + F P L  G++V+GQYEV+G IAHGGL
Sbjct  115  KRFCWKCNEPVGRKSASTRATQHGTCPKCGSTFDFRPLLEEGELVSGQYEVQGPIAHGGL  174

Query  163  GWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDR  222
            GWIYLA+DRNV+ R VVLKGL+H GD+EAQA+A+AERQFLAEV +PSIV+IFNFVEH   
Sbjct  175  GWIYLAIDRNVSDRWVVLKGLLHFGDSEAQAVAVAERQFLAEVANPSIVKIFNFVEHPRP  234

Query  223  HGDPVGYIVMEYVGGQSLKR-----SKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDL  277
             G P+GYIVMEYVGG+SL+        G+ +P+ +AI Y+LEILPALSYLHS GL YNDL
Sbjct  235  DGTPMGYIVMEYVGGRSLREVLAEFPDGKHMPIEQAIGYVLEILPALSYLHSTGLAYNDL  294

Query  278  KPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAA  337
            KPEN+M+TE+QLKLIDLGAVS I  +GYLYGT G+QAPEI+ TGPT+A+DI+TVGRTLA 
Sbjct  295  KPENVMVTEDQLKLIDLGAVSGIEDYGYLYGTAGYQAPEIIETGPTIASDIFTVGRTLAV  354

Query  338  LTLDLPTRNGRYVDGL--PEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGV  395
            LTLD+P+++GRY+DGL  PED+P+L+  + + RLL RA DPDP++RF +AEE++ QLTGV
Sbjct  355  LTLDMPSKHGRYLDGLPEPEDEPLLRDNEFFHRLLLRATDPDPKKRFQSAEEIAGQLTGV  414

Query  396  LREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSV  455
            LRE++A+ TG   PGLS +FS  R++FG D LV  TDVY+DG  H   L   E+  AL +
Sbjct  415  LREILAEQTGQENPGLSLVFSRQRTSFGTDELVGQTDVYVDGVSHDAALDPREVAHALPI  474

Query  456  PLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSESV--ELPLMEVRALL  513
            PLVDPTD +A +L A V S+P QTLD+L+ AR   +D      + ++  E+ L E +A L
Sbjct  475  PLVDPTDPSAPLLAAAVHSEPSQTLDALKHARENGIDRTSGTPAAAISGEVRLAEAKAHL  534

Query  514  DLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPK  573
            DLGD   A   LD+L + +G  W++ WYR +A L    ++ A  HF  VL    GE APK
Sbjct  535  DLGDPETALSVLDELQQSIGDHWKIEWYRGLAALQLDRFEPAFSHFETVLTALSGEAAPK  594

Query  574  LALAATAEL------AGNTDE-----HKFYQTVWSTNDGVISAAFGLARARSAEGDRVGA  622
            LALAATAEL      + + D+      K+Y+TVW T    +SAAFGLAR  +  G++  A
Sbjct  595  LALAATAELILQHWESDDPDQWCRFSEKYYRTVWRTERNYVSAAFGLARQLADHGNKKAA  654

Query  623  VRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIR  682
            +  LDEVP +SRH+  AR++SA+T+LSG   +E+ E  +R+AARRV ALP  E R LQ+R
Sbjct  655  IAALDEVPTSSRHYNVARMSSALTMLSGVPIAELDESTLREAARRVRALPAEESRSLQMR  714

Query  683  ALVLGGALDWLK-DNKAST--NHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVD  739
             LVLG ALDW++  N++ T    IL  PFT  GLR G EA LR+LAR   ++ HRY LVD
Sbjct  715  TLVLGTALDWIRYGNRSHTELEPILDLPFTEQGLRTGAEACLRALARATTSRTHRYALVD  774

Query  740  MANKVRPTSTF  750
             AN VRP S F
Sbjct  775  RANAVRPRSNF  785


>gi|111020581|ref|YP_703553.1| serine/threonine-protein kinase [Rhodococcus jostii RHA1]
 gi|110820111|gb|ABG95395.1| serine/threonine-protein kinase [Rhodococcus jostii RHA1]
Length=731

 Score =  719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/696 (57%), Positives = 477/696 (69%), Gaps = 32/696 (4%)

Query  81   IPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQ  140
            +P A     L  L+TNPV+ E KR+C  C RPVGRS +   G +EG C +CG+ +SF PQ
Sbjct  38   VPDAAHTSDLSMLLTNPVLAEHKRYCDRCKRPVGRSTAARPGDTEGVCTHCGTVFSFAPQ  97

Query  141  LNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQ  200
            L  G++VAGQYEV GC+AHGG+GWIYLALD NV+ R VVLKGL+HSGD EAQ +A+AER+
Sbjct  98   LEAGELVAGQYEVLGCLAHGGVGWIYLALDHNVSDRWVVLKGLLHSGDPEAQEVALAERR  157

Query  201  FLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQS-------LKRSKGQK-----L  248
            FLAEV HPSIV+I+NFVEH    G+P+GYIVMEYV G++       LK   G       L
Sbjct  158  FLAEVTHPSIVKIYNFVEHPGMDGNPIGYIVMEYVRGRTLRDLLTELKEDAGPDDPKPML  217

Query  249  PVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTE--EQLKLIDLGAVSRINSFGYL  306
            PV  AI YLLE+ PAL YLHS+GLVYNDLKPENIM+ +  +QLKLID+GAV+RI   GY+
Sbjct  218  PVEHAIRYLLEVTPALGYLHSMGLVYNDLKPENIMIGDDYDQLKLIDMGAVARIGDHGYI  277

Query  307  YGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGL--PEDDPVLKTYD  364
            YGT G+QAPEI  TGPTVA+DIYTVGRTLA +TLD+PT  G YVDGL  PE+ P+L  Y+
Sbjct  278  YGTQGYQAPEIATTGPTVASDIYTVGRTLAVVTLDMPTAGGCYVDGLPTPEEAPLLAEYE  337

Query  365  SYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGV  424
             Y RLL RAI PDP +RF +AEEMS QL GVLREV AQ TG P+PGLS  FSP R+TFG 
Sbjct  338  FYHRLLLRAIHPDPARRFASAEEMSTQLEGVLREVRAQQTGHPQPGLSHRFSPQRTTFGT  397

Query  425  DLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLR  484
            DL ++ TDVY+DG    E+++A  IV AL +PLVDP D AA +L + V S+P + LDSL 
Sbjct  398  DLTISRTDVYVDGHRRDERISAMSIVRALPIPLVDPDDPAAPLL-SVVHSRPRELLDSLH  456

Query  485  AARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAV  544
             A+  A   DGV  S S+E+PL EVRA LDLG    A   L+ L  +    WR+ W+  +
Sbjct  457  RAKEVA--DDGV-ASTSIEIPLAEVRAHLDLGQPRDAATILESLDHQREDTWRVDWHTGL  513

Query  545  AELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDE-----------HKFYQ  593
              L+ GD+++A   F  VL   PGE APKLALAATAE+                  K+Y 
Sbjct  514  CALVGGDFEAAFTRFDSVLTALPGEEAPKLALAATAEMWCEYRSGEDIGRWRRTAEKYYC  573

Query  594  TVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRST  653
            TVW T+ G +SAAFGL+R      DR  AV  LDEVPPTSRH+  ARLTS + L+  R  
Sbjct  574  TVWRTDHGAVSAAFGLSRQLEHRDDRAAAVEALDEVPPTSRHYAEARLTSVLMLVHDRPL  633

Query  654  SEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKA-STNHILGFPFTSHG  712
            +EV+E  +++AARRVE L   E R LQ R LVLG A+DWL       T  IL  PFT  G
Sbjct  634  AEVSERDLQEAARRVELLAHDERRALQTRVLVLGVAVDWLHAGGIPETTRILSVPFTERG  693

Query  713  LRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTS  748
            LR G E++LR+LAR AP +RHRYTLVD+AN +RPT+
Sbjct  694  LRTGAESALRALARKAPERRHRYTLVDLANLIRPTT  729


>gi|333918206|ref|YP_004491787.1| serine/threonine-protein kinase [Amycolicicoccus subflavus DQS3-9A1]
 gi|333480427|gb|AEF38987.1| Serine/threonine-protein kinase [Amycolicicoccus subflavus DQS3-9A1]
Length=804

 Score =  716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/709 (54%), Positives = 480/709 (68%), Gaps = 41/709 (5%)

Query  79   VEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFL  138
            VEIP  P IDP  A++TNP VPES+RFC +CG PVGRS    K   +G C  CG PY F 
Sbjct  100  VEIPAVPPIDPTTAILTNPAVPESERFCLHCGEPVGRSRGGEKAEPDGVCGTCGHPYWFT  159

Query  139  PQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAE  198
            P L  GDI+AGQYE++GC+AHGGLGWIYLA+DRNV  R VVLKGL+HSGDA+AQA+AMAE
Sbjct  160  PLLREGDIIAGQYEIRGCLAHGGLGWIYLAIDRNVEDRWVVLKGLLHSGDAKAQAVAMAE  219

Query  199  RQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGG-------QSLKRSKGQK---L  248
            R+FLAEV HPSIV+I+NFVEH +R G+ VGYIVMEYVGG       Q+ +++ G     +
Sbjct  220  RRFLAEVSHPSIVKIYNFVEHVNRSGETVGYIVMEYVGGTTLRHLVQNRRKATGDSDVCM  279

Query  249  PVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYG  308
            PV  AI  + E L AL YLH++GL YNDLKP+N+M+T+E +KLIDLGAV+ I S+GY++G
Sbjct  280  PVEHAIVLIQETLQALGYLHALGLTYNDLKPDNVMITDEGIKLIDLGAVAAIESYGYIFG  339

Query  309  TPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDP--VLKTYDSY  366
            TPGFQAPE+ RTGPTVA+DIYT GRTLAALT  +PT NG Y  GLP  D   + + ++ +
Sbjct  340  TPGFQAPELARTGPTVASDIYTAGRTLAALTTRMPTENGVYKPGLPTPDQELLFREHEFF  399

Query  367  GRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDL  426
             RLL RA + DP +RFT+AEEMS QLTGVLRE +AQ  G P PG+ST+FSP R+ FG D 
Sbjct  400  YRLLLRATNSDPEKRFTSAEEMSRQLTGVLREALAQKRGEPHPGMSTMFSPQRTAFGTDQ  459

Query  427  LVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAA  486
             V  TDVY+DG +    + A ++V AL +PLVDP+D AA +L AT  S P + LDS+R  
Sbjct  460  AVRQTDVYVDGHLRDMHVEARDVVAALPLPLVDPSDPAARLLAATAASDPSEILDSIRKI  519

Query  487  RHGALD--------ADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRL  538
            R  A +        +   DF ES+ +PL E+RA +DLG+  +A   ++ L       WRL
Sbjct  520  RETASEDRAAAADTSASADFEESLAVPLAEIRAHIDLGEPEQARELINQLRTDNQADWRL  579

Query  539  VWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAEL-----AGNTDE-----  588
             W+    ELL G++  A  HF  VL   PGE APK+ALAATAEL       + DE     
Sbjct  580  DWFSGFTELLVGEFQEAFDHFESVLSALPGEYAPKVALAATAELILDHWETDDDEVWHRF  639

Query  589  -HKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTL  647
              K+Y++VW T+  V+SAAFGLAR     G+R GAV  LD+VP +SRH+  ARL+S + L
Sbjct  640  AEKYYRSVWRTDRNVVSAAFGLARQLVHAGNRAGAVTELDQVPLSSRHYNVARLSSVMAL  699

Query  648  LSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNH-----  702
            + GR   ++ E ++R+AARRVE +P TE R LQ+R +VLG ALDWL+    + NH     
Sbjct  700  IGGRPVDQINELELREAARRVEMVPETERRSLQMRVVVLGVALDWLR----TGNHARYPE  755

Query  703  -ILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
              LG   T   LR   E +LR LAR AP +RHRY LVD+AN +RP S F
Sbjct  756  PFLGVTLTEESLRGSTERALRILARNAPERRHRYRLVDLANAIRPRSIF  804


>gi|262204221|ref|YP_003275429.1| serine/threonine protein kinase-like protein [Gordonia bronchialis 
DSM 43247]
 gi|262087568|gb|ACY23536.1| Serine/threonine protein kinase-related protein [Gordonia bronchialis 
DSM 43247]
Length=867

 Score =  705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/717 (53%), Positives = 480/717 (67%), Gaps = 39/717 (5%)

Query  72   RRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYC  131
            RRLG GLVE+P+  DI+P +A++  PV+PESKR CW CG+PVGR+    +G   G CP C
Sbjct  152  RRLGSGLVEMPKIVDIEPEDAVLLEPVIPESKRTCWRCGKPVGRTSGPGEGDISGICPNC  211

Query  132  GSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEA  191
            G+ YSF+P L PG +VA QYE+ G IAHGGLGWIYLA+DRNV+ RPVVLKGL++S D+EA
Sbjct  212  GARYSFVPGLEPGTVVADQYEITGAIAHGGLGWIYLAIDRNVSDRPVVLKGLLNSSDSEA  271

Query  192  QAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQK----  247
            Q +A+AERQFLA V HP IV+I+NFVEH    G+  GYIVMEY+GG++LK+    +    
Sbjct  272  QRVAVAERQFLASVNHPGIVKIYNFVEHISERGERYGYIVMEYIGGRTLKQITSDQSGTG  331

Query  248  -LPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYL  306
             L V +A+AY+LE+L A+ YLHS+GL+YND+KP+NIM+  +++KLIDLGAVS IN +G+L
Sbjct  332  LLSVEQAMAYILEVLLAVGYLHSVGLIYNDVKPDNIMVGSDEVKLIDLGAVSPINGYGHL  391

Query  307  YGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPE--DDPVLKTYD  364
            YGTPGFQAPEIV+TGP +A+DIY++GRTLA LT+ +  R GRYVDGLP+    PV     
Sbjct  392  YGTPGFQAPEIVKTGPQIASDIYSIGRTLAVLTVPIEMRKGRYVDGLPDPATTPVFAENP  451

Query  365  SYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGV  424
            SY  LL+RA   DP +RF +AEEMS Q+  VLRE VA  TGVPRP LST+F+P RSTFG 
Sbjct  452  SYYLLLQRATAADPAERFASAEEMSTQVLNVLRETVAVHTGVPRPALSTVFTPQRSTFGT  511

Query  425  DLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLR  484
            DL++A  D + D    A      +I  AL VPLV+P D AA +L +  LS P QTLDS+ 
Sbjct  512  DLMLAPVDGFFDPD-QAAFYDPVDIARALPVPLVNPLDPAAGLLTSAALSDPRQTLDSIN  570

Query  485  AAR-HGALDADG---VDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
            AAR  G +   G    D   S+E+ L E RA L+L DV  A   L +++   G  WR+ W
Sbjct  571  AARAEGFVSILGRRVNDGHPSLEIDLREARAHLELDDVDTALALLREISVHHGNSWRVQW  630

Query  541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGN--TDE----------  588
            Y  +  L+  + + A + F EVL   PGE+ PKLA+A TAEL G   +DE          
Sbjct  631  YMGICALMNDEPELAYERFDEVLGAMPGEVGPKLAVAGTAELIGRWLSDETDHSPGSAQR  690

Query  589  --------HKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTAR  640
                       Y  +W T+  +++AAFGLAR   A GD  GA+R LDEVP TSRHF TAR
Sbjct  691  ITELYDVAQHHYHDLWLTDHAIVTAAFGLARLSVAAGDYDGAIRPLDEVPATSRHFNTAR  750

Query  641  LTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDN----  696
             T+ + L+ GR  SEVT EQI +AARR+E +P +EPR  ++  +VLG AL W+  N    
Sbjct  751  ATAVIALVHGRDPSEVTREQIVEAARRLEQIPDSEPRKARMVLIVLGTALGWMHANPDAA  810

Query  697  --KASTNHILGFPFTSHGLRLGVEASLRSLARVAPTQR-HRYTLVDMANKVRPTSTF  750
                  + +LGFPFT HG+R G E SLR+LAR   T R HR+ LVD+AN VRP + F
Sbjct  811  HGSGEPSTLLGFPFTEHGIRTGTERSLRNLARQTRTNRDHRFMLVDLANYVRPDTLF  867


>gi|312141244|ref|YP_004008580.1| serine/threonine kinase [Rhodococcus equi 103S]
 gi|311890583|emb|CBH49901.1| putative serine/threonine kinase [Rhodococcus equi 103S]
Length=750

 Score =  704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/694 (56%), Positives = 485/694 (70%), Gaps = 24/694 (3%)

Query  77   GLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYS  136
            GLVE+P  P+ DP +A++T+P VPE KRFCW C +PVGR+     G+  G CP+CG+ Y 
Sbjct  61   GLVEVPPVPERDPQDAVLTDPHVPERKRFCWRCSKPVGRTTEAGPGSPSGICPHCGARYE  120

Query  137  FLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAM  196
            F P L+PG +VAGQYEV+GCIAHGGLGWIYLA+DRNV+ R VVLKGL+  GDAEAQA+A 
Sbjct  121  FSPLLSPGQLVAGQYEVQGCIAHGGLGWIYLAIDRNVDNRWVVLKGLLQLGDAEAQAVAA  180

Query  197  AERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQS----LKRSKGQKLPVAE  252
            AERQ LAEV HPSIV+I+NFVE+      P GY+VMEYVGG S    LK  +  +LP+ +
Sbjct  181  AERQILAEVQHPSIVKIYNFVEYHKEGHPPAGYLVMEYVGGNSLRDILKTCRPDRLPLEQ  240

Query  253  AIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGF  312
            AIAY+LEILPAL YLHS+GL YNDLKP+N+M+T+EQ+KLIDLGAV+ + S+GYLYGTPGF
Sbjct  241  AIAYILEILPALEYLHSLGLAYNDLKPDNVMVTDEQVKLIDLGAVAPLESYGYLYGTPGF  300

Query  313  QAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGL--PEDDPVLKTYDSYGRLL  370
            QAPEI  TGPTVA+DIYTVGRTLAALTLDLP+ +GRYVDGL  PE  P+L   +SY RLL
Sbjct  301  QAPEITETGPTVASDIYTVGRTLAALTLDLPSEDGRYVDGLPTPEQAPLLAENESYRRLL  360

Query  371  RRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAH  430
             RAI+PDP +RF +A E++AQLTGVL E+V++D+    P LST+F   R+TFG D  V  
Sbjct  361  LRAIEPDPDRRFRSASELAAQLTGVLHEIVSRDSEREHPYLSTVFGRQRATFGADEFVEQ  420

Query  431  TDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGA  490
            TDV+ DG     KL    +  +L+VPLVD  D  A+++ AT  S P   LD L  AR   
Sbjct  421  TDVFADGVERERKLNPRNVAQSLAVPLVDTDDPGAALVNATAHSDPQLMLDVLDRAR---  477

Query  491  LDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTG  550
             D+      +S+EL L E+RA LDLGD  KA + L  LA    + WR+ WYR +A LL+ 
Sbjct  478  -DSPERGVPDSLELKLAEIRAHLDLGDAGKARQLLRALAPAYPFEWRIDWYRGIAALLSD  536

Query  551  DYDSATKHFTEVLDTFPGELAPKLALAATA------ELAGNTDE-----HKFYQTVWSTN  599
            +  +A   F  V    PGE++PKLALAATA       +   TD       ++Y+TVW  +
Sbjct  537  ELTTAYASFDAVYSAMPGEVSPKLALAATAELLLEHHIESGTDRWRLPSREYYRTVWRID  596

Query  600  DGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEE  659
              V++AAFGLAR  +A+GD   AV  LD+VPP SR++  AR+T+ +T LS R    + E 
Sbjct  597  RNVVTAAFGLARRLAADGDVNAAVTALDQVPPGSRNYGAARMTAVLTYLSVRPIGAIDEA  656

Query  660  QIRDAARRVEALPPTEPRVLQIRALVLGGALDW-LKDNKASTNH--ILGFPFTSHGLRLG  716
             +R++ARRVEALP TE R  Q+R +VLG AL+W L  N  +T H  +LG PFT  GLR G
Sbjct  657  TLRESARRVEALPRTEIRGPQMRTVVLGTALEWILSGNTPTTAHEPLLGVPFTERGLRAG  716

Query  717  VEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
             EASLR++AR APT  HRYTLVD+AN VRP S F
Sbjct  717  TEASLRAMARSAPTPTHRYTLVDLANAVRPQSLF  750


>gi|325673925|ref|ZP_08153615.1| non-specific serine/threonine protein kinase [Rhodococcus equi 
ATCC 33707]
 gi|325555190|gb|EGD24862.1| non-specific serine/threonine protein kinase [Rhodococcus equi 
ATCC 33707]
Length=750

 Score =  703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/694 (56%), Positives = 486/694 (71%), Gaps = 24/694 (3%)

Query  77   GLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYS  136
            GLVE+P  P+ DP +A++T+P VPE KRFCW C +PVGR+     G+  G CP+CG+ Y 
Sbjct  61   GLVEVPPVPERDPQDAVLTDPHVPERKRFCWRCSKPVGRTTEAGPGSPSGICPHCGARYE  120

Query  137  FLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAM  196
            F P L+PG +VAGQYEV+GCIAHGGLGWIYLA+DRNV+ R VVLKGL+  GDAEAQA+A 
Sbjct  121  FSPLLSPGQLVAGQYEVQGCIAHGGLGWIYLAIDRNVDNRWVVLKGLLQLGDAEAQAVAA  180

Query  197  AERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQS----LKRSKGQKLPVAE  252
            AERQ LAEV HPSIV+I+NFVE+      P GY+VMEYVGG S    LK  +  +LP+ +
Sbjct  181  AERQILAEVQHPSIVKIYNFVEYHKEGHPPAGYLVMEYVGGNSLRDILKTCRPDRLPLEQ  240

Query  253  AIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYGTPGF  312
            AIAY+LEILPAL YLHS+GL YNDLKP+N+M+T+EQ+KLIDLGAV+ + S+GYLYGTPGF
Sbjct  241  AIAYILEILPALEYLHSLGLAYNDLKPDNVMVTDEQVKLIDLGAVAPLESYGYLYGTPGF  300

Query  313  QAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGL--PEDDPVLKTYDSYGRLL  370
            QAPEI  TGPTVA+DIYTVGRTLAALTLDLP+ +GRYVDGL  PE  P+L   +SY RLL
Sbjct  301  QAPEITETGPTVASDIYTVGRTLAALTLDLPSEDGRYVDGLPTPEQAPLLAENESYRRLL  360

Query  371  RRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDLLVAH  430
             RAI+PDP +RF +A E++AQLTGVL E+V++D+    P LST+F   R+TFG D  V  
Sbjct  361  LRAIEPDPDRRFRSASELAAQLTGVLHEIVSRDSEREHPYLSTVFGRQRATFGADEFVEQ  420

Query  431  TDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGA  490
            TDV+ DG     KL    +  +L+VPLVD  D  A+++ AT  S P   LD L  AR   
Sbjct  421  TDVFADGVERERKLNPRNVAQSLAVPLVDTDDPGAALVNATAHSDPQLMLDVLDRAR---  477

Query  491  LDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTG  550
             D+      +S+EL L E+RA LDLGD  KA + L  LA    + WR+ WYR +A LL+ 
Sbjct  478  -DSPERGVPDSLELKLAEIRAHLDLGDAGKARQLLRALAPAYPFEWRIDWYRGIAALLSD  536

Query  551  DYDSATKHFTEVLDTFPGELAPKLALAATAELA------GNTDE-----HKFYQTVWSTN  599
            +  +A   F  V    PGE++PKLALAATAEL         TD       ++Y+TVW  +
Sbjct  537  ELTTAYASFDAVYSAMPGEVSPKLALAATAELLLEHHSESGTDRWRLPSREYYRTVWRID  596

Query  600  DGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEE  659
              V++AAFGLAR  +A+GD   AV  LD+VPP SR++  AR+T+ +T LS R    + E 
Sbjct  597  RNVVTAAFGLARRLAADGDVNAAVTALDQVPPGSRNYGAARMTAVLTYLSVRPIGAIDEA  656

Query  660  QIRDAARRVEALPPTEPRVLQIRALVLGGALDW-LKDNKASTNH--ILGFPFTSHGLRLG  716
             +R++ARRVEALP TE R  Q+R +VLG AL+W L  N  +T H  +LG PFT  GLR G
Sbjct  657  TLRESARRVEALPRTEIRGPQMRTVVLGTALEWILSGNTPTTAHEPLLGVPFTERGLRAG  716

Query  717  VEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
             EASLR++AR APT  HRYTLVD+AN VRP S F
Sbjct  717  TEASLRAMARSAPTPTHRYTLVDLANAVRPQSLF  750


>gi|343924492|ref|ZP_08764041.1| serine/threonine protein kinase PknG [Gordonia alkanivorans NBRC 
16433]
 gi|343765636|dbj|GAA10967.1| serine/threonine protein kinase PknG [Gordonia alkanivorans NBRC 
16433]
Length=877

 Score =  702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/722 (53%), Positives = 479/722 (67%), Gaps = 49/722 (6%)

Query  72   RRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYC  131
            RRLG GLVE+P+  DI+P +A++ +PV+ E KRFCW CG+PVGR + E +G   G C  C
Sbjct  162  RRLGSGLVEMPKITDIEPEDAVIDDPVIAEGKRFCWRCGKPVGRLEGEGEGPPTGDCANC  221

Query  132  GSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEA  191
            G+ YSF+P L  G +VA QYE+ G IAHGGLGWIYLA+DRNV+ RPVVLKGL++S D+EA
Sbjct  222  GARYSFVPGLAQGTLVADQYEIAGAIAHGGLGWIYLAIDRNVSDRPVVLKGLLNSSDSEA  281

Query  192  QAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKR-----SKGQ  246
            Q +A+AERQFLA V HP IV+I+NFVEH    G+  GYIVMEY+GGQ+LK+      +  
Sbjct  282  QRVAVAERQFLASVNHPGIVKIYNFVEHISDDGERFGYIVMEYIGGQTLKQITSGDPEKS  341

Query  247  KLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYL  306
             L V + +AY+LE+L A+ YLHS+GLVYND+KPENIM+  +++KLIDLGAVS IN +G+L
Sbjct  342  LLSVEQGLAYILEVLLAVGYLHSVGLVYNDVKPENIMVGSDEVKLIDLGAVSPINGYGHL  401

Query  307  YGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDD--PVLKTYD  364
            YGTPGFQAPEIV+TGP VATDIY+VGRTLA LT+ +  RNGRYVDGLP  D   V +   
Sbjct  402  YGTPGFQAPEIVKTGPQVATDIYSVGRTLAVLTVPMEMRNGRYVDGLPAPDETAVFRDNP  461

Query  365  SYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGV  424
            S+  LL+RA  PDP  RF +AEEMS Q+  VLRE VA  TGVPRP LST+F+P RSTFG 
Sbjct  462  SFYLLLQRATAPDPADRFASAEEMSTQVLNVLRETVAVHTGVPRPSLSTVFTPQRSTFGT  521

Query  425  DLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLR  484
            DL++A  D + D    A      +I TAL +PLV+P D AAS+L +  LS P QTLDS+ 
Sbjct  522  DLMLAPVDGFFDPD-QAAFYDPVDIATALPLPLVNPLDPAASLLTSAALSDPRQTLDSIN  580

Query  485  AARHGALDADGV----------DFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGW  534
             AR     A+G           +   S+E+ L E RA L L DV  A   L D+ E  G 
Sbjct  581  TAR-----AEGFASLFGGRPVKNAHPSLEIDLAEARAHLQLDDVDTALALLRDVREHHGD  635

Query  535  RWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGN--TDEH---  589
             WR+ WY  +  L+  + + A + F EVL   PGE+APKLA+A TAEL G    DE+   
Sbjct  636  SWRVEWYMGICALMNDEPELAYERFDEVLGAMPGEVAPKLAVAGTAELIGRWLADENGSS  695

Query  590  --------------KFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRH  635
                            Y  +W T+  +++AAFGLAR   A GD  GA+R LDEVP TSRH
Sbjct  696  KSADKISRLYDVAQHHYHDLWLTDHSIVTAAFGLARLAVAAGDYDGAIRPLDEVPATSRH  755

Query  636  FTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKD  695
            F TAR T+ + L+ GR TS+VT  QI +AARR+E +P TEPR  ++  +VLG AL W+ D
Sbjct  756  FNTARATAIIALVHGRPTSQVTRNQIVEAARRLEQIPDTEPRKSRMLLIVLGTALGWIHD  815

Query  696  NKASTNH------ILGFPFTSHGLRLGVEASLRSLARVAPTQR-HRYTLVDMANKVRPTS  748
            N    +       +LGFPFT +G+R G E SLR LAR     R HR+ LVD+AN VRP +
Sbjct  816  NPEEEDSDKEPSTLLGFPFTEYGIRTGTERSLRQLARQTRNNREHRFMLVDLANYVRPNT  875

Query  749  TF  750
             F
Sbjct  876  LF  877


>gi|296141429|ref|YP_003648672.1| serine/threonine protein kinase [Tsukamurella paurometabola DSM 
20162]
 gi|296029563|gb|ADG80333.1| serine/threonine protein kinase [Tsukamurella paurometabola DSM 
20162]
Length=773

 Score =  699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/699 (54%), Positives = 477/699 (69%), Gaps = 30/699 (4%)

Query  72   RRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYC  131
            RR+GGGLVEIPR  ++DP EA+ TNP++ E KR+CWNC +PVGR+     G   G CP+C
Sbjct  85   RRVGGGLVEIPRITEVDPSEAITTNPIIAEGKRYCWNCRKPVGRAHDGEPGPLIGTCPHC  144

Query  132  GSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEA  191
            G+ +SF P L  GDIVA QYE+KG IAHGG+GWIYLA D NV  RPVVLKGL++SGDA+A
Sbjct  145  GARFSFEPALKAGDIVADQYEIKGAIAHGGMGWIYLATDINVVDRPVVLKGLLNSGDAQA  204

Query  192  QAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQ---KL  248
            QA+A++ER+FLAE+ HPSIV+I+NFVEH D  G  +GYIVMEYV G+++K    +   K+
Sbjct  205  QAVAVSERRFLAEMTHPSIVKIYNFVEHPDPDGTRIGYIVMEYVPGKTVKEILAEAESKV  264

Query  249  PVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGYLYG  308
             V +AIAY+LE+LPAL YLHS+GL YNDLKP+NIM++EE +KLIDLGAV+ +  +GY+YG
Sbjct  265  EVEQAIAYILEVLPALGYLHSLGLAYNDLKPDNIMISEEDVKLIDLGAVAPLGGYGYIYG  324

Query  309  TPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPE--DDPVLKTYDSY  366
            TPGFQAPEI +TGPTVA+D+YTVGRTLA L   +    GRYVDGLP   DD  L TY+S 
Sbjct  325  TPGFQAPEIAKTGPTVASDVYTVGRTLAVLVAKIAMDKGRYVDGLPTPVDDATLATYNSL  384

Query  367  GRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGVDL  426
             RLL +A   DP +RF++A E++ QL GVLRE ++  +G PRPGLS +F+P RSTFGV+L
Sbjct  385  YRLLVKATAEDPEERFSSAAELTDQLLGVLRECLSTKSGEPRPGLSMVFTPQRSTFGVEL  444

Query  427  LVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAA  486
            ++   D   D +VH + L A E++ AL +P+ +P D AA VL  T+ S P Q LDSL   
Sbjct  445  MLRAVDP--DPEVHDDMLRAPEVLAALPIPIANPADPAAGVLALTMRSDPTQVLDSLAEL  502

Query  487  RHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAE  546
            R           + +VE+ L E RA L+LG+V  AT  LD LA R   RW++ WYRA   
Sbjct  503  RE--------TMAGTVEIDLAEARAHLELGEVDAATTLLDSLAAREPHRWQVTWYRAETA  554

Query  547  LLTGDYDSATKHFTEVLDTFPGELAPKLALAATAE---LAGNTDEHKF-------YQTVW  596
            L+ GDY +A  HF  V D  PGE APKLA A  AE   L+G +D   +       Y++VW
Sbjct  555  LMQGDYATAYDHFEAVTDQAPGEAAPKLAAAVAAEFCFLSGESDPDGWRDRARERYESVW  614

Query  597  STNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEV  656
             T+ G+ISAAFG AR R A  D VG V  LD+VP TSRH+  A  +S V L+ GR  ++V
Sbjct  615  RTDRGIISAAFGAARMRRAASDIVGTVEILDQVPSTSRHYHNALCSSVVALVHGRDLAQV  674

Query  657  TEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKA-----STNHILGFPFTSH  711
            TE Q+ +AARRV  LP +E R LQ+RALVLG AL W++          T  +L    T  
Sbjct  675  TEAQLHEAARRVRTLPKSEWRRLQLRALVLGVALGWVQHRNQHGRLDGTATLLDHALTER  734

Query  712  GLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
            GLR   E +LR LA +A  +R R+ LVD+AN +RPT+ F
Sbjct  735  GLRKATEKALRDLAALAERKRQRHALVDLANAIRPTTVF  773


>gi|226362802|ref|YP_002780580.1| serine/threonine protein kinase [Rhodococcus opacus B4]
 gi|226241287|dbj|BAH51635.1| serine/threonine protein kinase [Rhodococcus opacus B4]
Length=735

 Score =  699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/696 (57%), Positives = 479/696 (69%), Gaps = 31/696 (4%)

Query  81   IPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQ  140
            +P A     L  L+TNPV+ E KR+C  C RPVGRS +   G +EG C +CG+ +SF PQ
Sbjct  41   VPDAAHTSDLSMLLTNPVLAEHKRYCDRCKRPVGRSTAARPGDTEGVCTHCGTVFSFAPQ  100

Query  141  LNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQ  200
            L  G++VAGQYEV GC+AHGG+GWIYLALD NV+ R VVLKGL+HSGD EAQ +A+AERQ
Sbjct  101  LEAGELVAGQYEVLGCLAHGGVGWIYLALDHNVSDRWVVLKGLLHSGDPEAQEVALAERQ  160

Query  201  FLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQ------------KL  248
            FLAEV HPSIV+I+NFVEH    G+PVGYIVMEYV G++L+    +            +L
Sbjct  161  FLAEVTHPSIVKIYNFVEHPGMDGNPVGYIVMEYVRGRTLRDVLTELKEESAPDDPKPRL  220

Query  249  PVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTE--EQLKLIDLGAVSRINSFGYL  306
            PV  AI YLLE+ PAL YLHS+GLVYNDLKPENIM+ +  +QLKLID+GAV+RI   GY+
Sbjct  221  PVEHAIRYLLEVTPALGYLHSMGLVYNDLKPENIMIGDDYDQLKLIDMGAVARIGDHGYI  280

Query  307  YGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGL--PEDDPVLKTYD  364
            YGT G+QAPEI  TGPTVA+DIYTVGRTLA LTLD+PT  G YVDGL  PE  P+L  Y+
Sbjct  281  YGTQGYQAPEIATTGPTVASDIYTVGRTLAVLTLDMPTAGGCYVDGLPSPEAAPLLAEYE  340

Query  365  SYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFGV  424
             Y RLL RAI PDP +RF +A+EMS QL GVLREV AQ TG P+PGLS  FSP R+TFG 
Sbjct  341  FYQRLLLRAIHPDPTKRFASADEMSTQLEGVLREVRAQRTGNPQPGLSHRFSPQRTTFGT  400

Query  425  DLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSLR  484
            DL ++ TDVY+DG    E ++A  IV AL +PLVDP D AA +L + V S+P + LDSL 
Sbjct  401  DLTISRTDVYVDGHRRDECISAMSIVRALPIPLVDPDDPAAPLL-SVVHSRPRELLDSLH  459

Query  485  AARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAV  544
             A+  A   +G + S S+E+PL EVRA LDLG    A   L+ L  ++   WR+ W+  +
Sbjct  460  RAKEVA-SGEG-EASTSIEIPLAEVRAHLDLGQPRDAATILESLDHQLEDTWRVDWHTGL  517

Query  545  AELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAEL-----AGNT------DEHKFYQ  593
              L+ GD+++A   F  VL   PGE APKLALAATAE+     AG           K+Y+
Sbjct  518  CALVGGDFEAAFTRFDSVLTALPGEEAPKLALAATAEMWCEYRAGENLGRWRGTAEKYYR  577

Query  594  TVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRST  653
            TVW T+ G +SAAFGLAR      DR  AV  LDEVPPTSRH+  ARLTS + L+  R  
Sbjct  578  TVWRTDHGAVSAAFGLARQLEHRDDRANAVEALDEVPPTSRHYAEARLTSVLMLVHDRPL  637

Query  654  SEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKA-STNHILGFPFTSHG  712
            +EV+E  +++AARRVE L   E R LQ R LVLG A+DWL           LG PFT  G
Sbjct  638  AEVSERDLQEAARRVELLAHDERRALQTRVLVLGVAVDWLHAGGVPEATRFLGVPFTERG  697

Query  713  LRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTS  748
            LR G EA+LR+LAR AP +RHRYTLVD+AN +RPT+
Sbjct  698  LRAGAEAALRALARKAPERRHRYTLVDLANLIRPTT  733


>gi|326384624|ref|ZP_08206302.1| serine/threonine protein kinase-like protein [Gordonia neofelifaecis 
NRRL B-59395]
 gi|326196591|gb|EGD53787.1| serine/threonine protein kinase-like protein [Gordonia neofelifaecis 
NRRL B-59395]
Length=808

 Score =  672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/721 (51%), Positives = 477/721 (67%), Gaps = 44/721 (6%)

Query  72   RRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYC  131
            RRLG  LV++P   DIDP +A++++PV+  SKR CW CG PVGR     KG   G C  C
Sbjct  90   RRLGSELVQLPEITDIDPADAVLSDPVIAPSKRKCWQCGEPVGRKSGRGKGPLSGTCWNC  149

Query  132  GSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEA  191
            G+ YSF+P L  G +VA QYE+ G IAHGG+GWIYLA+D NV+ RPVVLKGL++S D++A
Sbjct  150  GARYSFVPGLKRGTMVADQYEIAGAIAHGGMGWIYLAVDHNVSDRPVVLKGLLNSSDSQA  209

Query  192  QAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKR------SKG  245
            QA+A+AERQFLA V  P IV+IFNFV+     G  VGYIVMEYVGG +LK+         
Sbjct  210  QAVAIAERQFLASVNDPGIVKIFNFVDGVTEDGRSVGYIVMEYVGGHTLKQLTTEDDGGS  269

Query  246  QKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRINSFGY  305
            + LP+ +A+AY+LE+L A+ YLHS+GLVYND+KP+NIM+T + +KLIDLGAVS IN  G+
Sbjct  270  RHLPIEQAMAYILEVLSAVGYLHSVGLVYNDVKPDNIMITSDDVKLIDLGAVSAINGTGH  329

Query  306  LYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGL--PEDDPVLKTY  363
            LYGTPGFQAPEIV TGP + TDIY++GRTLA LT+D+P   GRY+DGL  P+  P+    
Sbjct  330  LYGTPGFQAPEIVETGPQIVTDIYSIGRTLAVLTVDMPMAEGRYLDGLPDPQTTPLFVEN  389

Query  364  DSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRSTFG  423
             S+  LL RA   DP +RF++AEEM+ Q+  VLRE VA  TGVPRP +ST+F+P RSTFG
Sbjct  390  PSFYFLLHRATSADPAERFSSAEEMTTQVLNVLRETVALHTGVPRPSMSTVFTPQRSTFG  449

Query  424  VDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTLDSL  483
             DLL+A  D + D +  A    A+ I  AL VPLVDP D AASVL +  LS P QTLD++
Sbjct  450  TDLLLAPVDGFFDPKDAAIHDPAD-IARALPVPLVDPADPAASVLTSAALSYPRQTLDTI  508

Query  484  RAAR---HGAL-----DADGVDFSE-SVELPLMEVRALLDLGDVAKATRKLDDLAERVGW  534
            RAAR   + AL      ADG   S  S+EL L E RA L+LG++  A + L ++A   G 
Sbjct  509  RAARADGYKALIASEPTADGEPPSHPSLELDLAEARAHLELGNLDTALQLLREVAVHHGD  568

Query  535  RWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAG---NTDEH--  589
             WRL WY  +  LL  + + A + F EVL+  PGE+APKLA+A TAEL G   + +E+  
Sbjct  569  SWRLQWYLGICSLLNAEPELAFERFHEVLEAMPGEVAPKLAVAGTAELIGYWLSAEEYTS  628

Query  590  ---------------KFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSR  634
                           + Y  +W T+ G++SAAFGLAR   AE    GA+  LDEVP TSR
Sbjct  629  NDQMAQVERWYEIARQNYHDLWLTDHGIVSAAFGLARMILAEDRYDGAIEPLDEVPTTSR  688

Query  635  HFTTARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLK  694
            H+ TA++++ VTL+ GR  SEVT  ++ +AA R E +   +PR  +++ ++LG AL W+ 
Sbjct  689  HYGTAQISAIVTLVHGRQPSEVTRSELFEAAERFEEISWDDPRRGRLQLIILGTALGWI-  747

Query  695  DNKASTNH----ILGFPFTSHGLRLGVEASLRSLARVAPTQR-HRYTLVDMANKVRPTST  749
            D     +H     LGFPF  HGLR G E SLR LA+     R HR+ LVD+AN +RP + 
Sbjct  748  DAHLHEDHAADDFLGFPFNEHGLRAGTERSLRELAKATRDNRAHRFLLVDLANLIRPATL  807

Query  750  F  750
            F
Sbjct  808  F  808


>gi|317509499|ref|ZP_07967112.1| serine/threonine protein kinase [Segniliparus rugosus ATCC BAA-974]
 gi|316252203|gb|EFV11660.1| serine/threonine protein kinase [Segniliparus rugosus ATCC BAA-974]
Length=741

 Score =  663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/701 (53%), Positives = 465/701 (67%), Gaps = 37/701 (5%)

Query  72   RRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSETKGASEGWCPYC  131
            R +GGGLV IP  P +DP  ALM +P VPESKRFCW C  PVGR D    G  EG C  C
Sbjct  56   RLIGGGLVRIPPVPSLDPALALMPDPQVPESKRFCWKCHAPVGRKDDNGPGLPEGVCANC  115

Query  132  GSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEA  191
             +P+SFLPQL  G++VAGQY V+G IAHGGLGWIYLA DRNV+ RPVVLKGL+  GDA A
Sbjct  116  STPFSFLPQLKAGEMVAGQYVVRGPIAHGGLGWIYLAEDRNVDNRPVVLKGLLSRGDASA  175

Query  192  QAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLK-----RSKG-  245
            QA+A AERQFL+EV HP IV+I NFVEH D  G PVGYIVM+YVGG SL+     R  G 
Sbjct  176  QAIARAERQFLSEVSHPGIVEILNFVEHPDPDGVPVGYIVMQYVGGVSLRDLLYGRQPGS  235

Query  246  ---------QKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGA  296
                     + LPV +A+AYL+EI+PAL YLHS+GLVYNDLKPENIMLTE QLKLIDLGA
Sbjct  236  PPLGGALHRKSLPVEQALAYLMEIMPALGYLHSVGLVYNDLKPENIMLTEGQLKLIDLGA  295

Query  297  VSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGL--P  354
            V+ ++    LYGT G+QAPE+  TGPTV TD++TVGRTLA LT+DLP  NGRY +GL  P
Sbjct  296  VTSMHDTARLYGTVGYQAPELTLTGPTVQTDLFTVGRTLAVLTVDLPLANGRYAEGLPEP  355

Query  355  EDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTI  414
            ED+P+   Y SY + L RA  P  R RF +A EM AQ++GVLREV+A+  G P P  ST+
Sbjct  356  EDEPLFARYPSYYQFLLRATHPSSRARFQSATEMLAQMSGVLREVLAERRGKPYPVSSTL  415

Query  415  FSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLS  474
            F+ +R+ FG ++L    DVY DG+    +L  +E+V  L +PLVDP   +A++L   + +
Sbjct  416  FTATRAEFGTNVLARRLDVYADGRDRRGELRPSEVVQTLPLPLVDPAHPSAALLATLLHT  475

Query  475  QPVQTLDSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDL-AERVG  533
            +P   L+S+ A    AL+A+  D +E+V   L  VR  + LG + +A R LDDL A R  
Sbjct  476  KPEHALESVTA----ALEAN-PDDTETV---LAAVRVKIGLGKLDEAARLLDDLYAPR--  525

Query  534  WRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQ  593
              WR  WY+    LL GD D A K F EV    PGE APKLALAA  EL G++    FY+
Sbjct  526  -NWRPSWYQGNLSLLQGDLDEARKSFEEVWGMLPGESAPKLALAAVLELLGDSSAKTFYR  584

Query  594  TVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRST  653
              WST+D +ISAAFGLAR  +AEGD +GAV  LD+VP +SRH   A +T+ + LL     
Sbjct  585  LCWSTDDAMISAAFGLARRLAAEGDSLGAVAALDKVPASSRHAGIAAVTAIIILLQ----  640

Query  654  SEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKA----STNHILGFPFT  709
             +V E+++R AA R ++LP  EPR L  RA +LG A+ W++D  A     +  +LG  FT
Sbjct  641  DQVDEDRLRAAAERQQSLPEEEPRALAARAFILGKAIQWMQDRPAYSPPPSGALLGRAFT  700

Query  710  SHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
               LR   E+ LR+LA+ A  +  RY LVD+AN VRP +  
Sbjct  701  MRALRRQAESVLRALAKRAAHRSQRYALVDLANLVRPRTII  741


>gi|296392569|ref|YP_003657453.1| serine/threonine protein kinase [Segniliparus rotundus DSM 44985]
 gi|296179716|gb|ADG96622.1| serine/threonine protein kinase [Segniliparus rotundus DSM 44985]
Length=724

 Score =  652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/716 (53%), Positives = 465/716 (65%), Gaps = 37/716 (5%)

Query  57   PQDRMATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRS  116
            P  R   T  V    R +GGGLV I  AP +DP  ALM +P VPE+KRFCW C  PVGR 
Sbjct  24   PAKRAERTVTVPLSERLIGGGLVRIQPAPALDPSLALMPDPQVPENKRFCWKCHAPVGRK  83

Query  117  DSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGR  176
              +  G  EG C  CG+P+SFLPQL  G++VAGQY V+G IAHGGLGWIYLA DRNV+ R
Sbjct  84   GPDDPGLPEGVCGNCGTPFSFLPQLKAGEVVAGQYVVRGPIAHGGLGWIYLAEDRNVDNR  143

Query  177  PVVLKGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVG  236
            PVVLKGL+  GDA AQA+A AERQFL+EV HP+IV+I NFVEH D  G PVGYIVM+Y+G
Sbjct  144  PVVLKGLLSRGDASAQAIARAERQFLSEVSHPAIVEILNFVEHPDLDGVPVGYIVMQYIG  203

Query  237  GQSLK-----RSKGQ----------KLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPEN  281
            G SL+     R  G            LPV +A+AYL+EI+PAL YLHSIGL YNDLKPEN
Sbjct  204  GVSLRDLLYGRKPGSPPLGGALRRTSLPVEQALAYLMEIMPALGYLHSIGLAYNDLKPEN  263

Query  282  IMLTEEQLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLD  341
            IMLTE QL LIDLGAV+ ++    LYGT G+QAPE+  TGPTV TD++TVGRTLA LT+D
Sbjct  264  IMLTEGQLTLIDLGAVTSMHDTNRLYGTVGYQAPELTLTGPTVQTDVFTVGRTLAVLTVD  323

Query  342  LPTRNGRYVDGL--PEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREV  399
            LP   GRY +GL  P+++PV   Y SY +LL RA  P+ R RF +A EMS Q++GVLREV
Sbjct  324  LPLDKGRYAEGLPSPQEEPVFAKYPSYYQLLLRATHPNSRARFQSASEMSVQMSGVLREV  383

Query  400  VAQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVD  459
            +A+  G P P  ST+F+ SR  FG D+L    DVY DG+    +L  +E+V AL +PLVD
Sbjct  384  LAERRGRPYPSSSTLFTASRGEFGTDVLSRRLDVYADGRDRRGELRRDEVVQALPLPLVD  443

Query  460  PTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVA  519
            P   +A++L   + ++P   L+S+     GAL++D  D +E+V   L  VR  + LG + 
Sbjct  444  PAHPSAALLATLLHTKPEHALESVT----GALESD-PDDTETV---LAAVRVHMGLGQLD  495

Query  520  KATRKLDDL-AERVGWRWRLVWYRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAA  578
            +A R LD+L A R    WR  WY+    LL GD + A K F EV    PGE APKLALA 
Sbjct  496  EAARLLDNLYAPR---NWRPSWYQGNLALLQGDLEEAKKSFEEVWGMLPGEPAPKLALAV  552

Query  579  TAELAGNTDEHKFYQTVWSTNDGVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTT  638
              EL  +      Y+   +T+DG+ISA FGLAR  SAEGD +GAV  LD+VP +SRH  T
Sbjct  553  VLELLDDPAAKTLYRLCSTTDDGLISATFGLARRLSAEGDPMGAVAALDKVPSSSRHAAT  612

Query  639  ARLTSAVTLLSGRSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKA  698
            A +++ V LL      EV E+ +R AA R + LP  EPR L  RAL+LG A+DW++   A
Sbjct  613  ATVSAIVILLK----DEVDEDLLRAAAERQQRLPKEEPRTLAARALLLGKAVDWMQGRPA  668

Query  699  S----TNHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF  750
                 +   LG PFT H LR   E  LR+LA+ A  +  RY LVD+AN VRP + F
Sbjct  669  HSPPLSGSFLGKPFTLHSLRRQSEFVLRALAKRAAHRSQRYALVDLANIVRPRTVF  724



Lambda     K      H
   0.317    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 1785465975048




  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
    Posted date:  Sep 5, 2011  4:36 AM
  Number of letters in database: 5,219,829,388
  Number of sequences in database:  15,229,318



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40